From a5b5bb0b49f2610fbd9d7a69661955cee813c0e74964c42cca7097df72e8d3b6 Mon Sep 17 00:00:00 2001 From: Mexpert_PRO Date: Sat, 17 Jan 2026 09:35:36 +0100 Subject: [PATCH] added basic glfw stuff --- TSE_GlfwImpl/CMakeLists.txt | 58 + TSE_GlfwImpl/include/GLFW/glfw3.h | 6547 +++++++++++++++++ TSE_GlfwImpl/include/GLFW/glfw3native.h | 663 ++ TSE_GlfwImpl/src/WindowGlfw.cpp | 134 + TSE_GlfwImpl/src/WindowGlfw.hpp | 40 + TSE_GlfwOpenGlImpl/CMakeLists.txt | 60 + TSE_GlfwOpenGlImpl/include/GL/gl3w.h | 1393 ++++ TSE_GlfwOpenGlImpl/include/GL/glcorearb.h | 5997 +++++++++++++++ TSE_GlfwOpenGlImpl/include/KHR/khrplatform.h | 311 + .../src/OpenGLRenderingBackend.cpp | 94 + .../src/OpenGLRenderingBackend.hpp | 26 + TSE_Math/CMakeLists.txt | 1 - 12 files changed, 15323 insertions(+), 1 deletion(-) create mode 100644 TSE_GlfwImpl/CMakeLists.txt create mode 100644 TSE_GlfwImpl/include/GLFW/glfw3.h create mode 100644 TSE_GlfwImpl/include/GLFW/glfw3native.h create mode 100644 TSE_GlfwImpl/src/WindowGlfw.cpp create mode 100644 TSE_GlfwImpl/src/WindowGlfw.hpp create mode 100644 TSE_GlfwOpenGlImpl/CMakeLists.txt create mode 100644 TSE_GlfwOpenGlImpl/include/GL/gl3w.h create mode 100644 TSE_GlfwOpenGlImpl/include/GL/glcorearb.h create mode 100644 TSE_GlfwOpenGlImpl/include/KHR/khrplatform.h create mode 100644 TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.cpp create mode 100644 TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.hpp diff --git a/TSE_GlfwImpl/CMakeLists.txt b/TSE_GlfwImpl/CMakeLists.txt new file mode 100644 index 0000000..edd0125 --- /dev/null +++ b/TSE_GlfwImpl/CMakeLists.txt @@ -0,0 +1,58 @@ +#cmake version +cmake_minimum_required(VERSION 3.31) + +#project name +project(TSE_GlfwImpl) + +#cpp settings +find_program(CLANG_C NAMES clang) +find_program(CLANG_CXX NAMES clang++) + +if(CLANG_C AND CLANG_CXX) + message(STATUS "foung Clang, using as Compiler") + set(CMAKE_C_COMPILER ${CLANG_C} CACHE STRING "C Compiler" FORCE) + set(CMAKE_CXX_COMPILER ${CLANG_CXX} CACHE STRING "C++ Compiler" FORCE) +else() + message(STATUS "Clang not found, using Standard-Compiler") +endif() +set(CMAKE_CXX_STANDARD 20) +set(CMAKE_CXX_STANDARD_REQUIRED True) + +#project output settings +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY "${PROJECT_SOURCE_DIR}/lib") +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY_DEBUG "${PROJECT_SOURCE_DIR}/lib/Debug") +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY_RELEASE "${PROJECT_SOURCE_DIR}/lib/Release") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY "${PROJECT_SOURCE_DIR}/lib") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY_DEBUG "${PROJECT_SOURCE_DIR}/lib/Debug") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY_RELEASE "${PROJECT_SOURCE_DIR}/lib/Release") + +#source files +file(GLOB CPP_SOURCE_TSE + "${PROJECT_SOURCE_DIR}/src/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*/*/*.c" +) + +#includes +include_directories(${PROJECT_SOURCE_DIR}/src) +include_directories(${PROJECT_SOURCE_DIR}/include) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Base/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Base/include) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Math/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Core/src) + +#project def +if(Lib) + add_library(TSE_GlfwImpl SHARED ${CPP_SOURCE_TSE}) +else() + add_library(TSE_GlfwImpl STATIC ${CPP_SOURCE_TSE}) +endif() + +#flags +target_compile_options(TSE_GlfwImpl PRIVATE -march=native) + diff --git a/TSE_GlfwImpl/include/GLFW/glfw3.h b/TSE_GlfwImpl/include/GLFW/glfw3.h new file mode 100644 index 0000000..0389130 --- /dev/null +++ b/TSE_GlfwImpl/include/GLFW/glfw3.h @@ -0,0 +1,6547 @@ +/************************************************************************* + * GLFW 3.4 - www.glfw.org + * A library for OpenGL, window and input + *------------------------------------------------------------------------ + * Copyright (c) 2002-2006 Marcus Geelnard + * Copyright (c) 2006-2019 Camilla Löwy + * + * This software is provided 'as-is', without any express or implied + * warranty. In no event will the authors be held liable for any damages + * arising from the use of this software. + * + * Permission is granted to anyone to use this software for any purpose, + * including commercial applications, and to alter it and redistribute it + * freely, subject to the following restrictions: + * + * 1. The origin of this software must not be misrepresented; you must not + * claim that you wrote the original software. If you use this software + * in a product, an acknowledgment in the product documentation would + * be appreciated but is not required. + * + * 2. Altered source versions must be plainly marked as such, and must not + * be misrepresented as being the original software. + * + * 3. This notice may not be removed or altered from any source + * distribution. + * + *************************************************************************/ + +#ifndef _glfw3_h_ +#define _glfw3_h_ + +#ifdef __cplusplus +extern "C" { +#endif + + +/************************************************************************* + * Doxygen documentation + *************************************************************************/ + +/*! @file glfw3.h + * @brief The header of the GLFW 3 API. + * + * This is the header file of the GLFW 3 API. It defines all its types and + * declares all its functions. + * + * For more information about how to use this file, see @ref build_include. + */ +/*! @defgroup context Context reference + * @brief Functions and types related to OpenGL and OpenGL ES contexts. + * + * This is the reference documentation for OpenGL and OpenGL ES context related + * functions. For more task-oriented information, see the @ref context_guide. + */ +/*! @defgroup vulkan Vulkan support reference + * @brief Functions and types related to Vulkan. + * + * This is the reference documentation for Vulkan related functions and types. + * For more task-oriented information, see the @ref vulkan_guide. + */ +/*! @defgroup init Initialization, version and error reference + * @brief Functions and types related to initialization and error handling. + * + * This is the reference documentation for initialization and termination of + * the library, version management and error handling. For more task-oriented + * information, see the @ref intro_guide. + */ +/*! @defgroup input Input reference + * @brief Functions and types related to input handling. + * + * This is the reference documentation for input related functions and types. + * For more task-oriented information, see the @ref input_guide. + */ +/*! @defgroup monitor Monitor reference + * @brief Functions and types related to monitors. + * + * This is the reference documentation for monitor related functions and types. + * For more task-oriented information, see the @ref monitor_guide. + */ +/*! @defgroup window Window reference + * @brief Functions and types related to windows. + * + * This is the reference documentation for window related functions and types, + * including creation, deletion and event polling. For more task-oriented + * information, see the @ref window_guide. + */ + + +/************************************************************************* + * Compiler- and platform-specific preprocessor work + *************************************************************************/ + +/* If we are we on Windows, we want a single define for it. + */ +#if !defined(_WIN32) && (defined(__WIN32__) || defined(WIN32) || defined(__MINGW32__)) + #define _WIN32 +#endif /* _WIN32 */ + +/* Include because most Windows GLU headers need wchar_t and + * the macOS OpenGL header blocks the definition of ptrdiff_t by glext.h. + * Include it unconditionally to avoid surprising side-effects. + */ +#include + +/* Include because it is needed by Vulkan and related functions. + * Include it unconditionally to avoid surprising side-effects. + */ +#include + +#if defined(GLFW_INCLUDE_VULKAN) + #include +#endif /* Vulkan header */ + +/* The Vulkan header may have indirectly included windows.h (because of + * VK_USE_PLATFORM_WIN32_KHR) so we offer our replacement symbols after it. + */ + +/* It is customary to use APIENTRY for OpenGL function pointer declarations on + * all platforms. Additionally, the Windows OpenGL header needs APIENTRY. + */ +#if !defined(APIENTRY) + #if defined(_WIN32) + #define APIENTRY __stdcall + #else + #define APIENTRY + #endif + #define GLFW_APIENTRY_DEFINED +#endif /* APIENTRY */ + +/* Some Windows OpenGL headers need this. + */ +#if !defined(WINGDIAPI) && defined(_WIN32) + #define WINGDIAPI __declspec(dllimport) + #define GLFW_WINGDIAPI_DEFINED +#endif /* WINGDIAPI */ + +/* Some Windows GLU headers need this. + */ +#if !defined(CALLBACK) && defined(_WIN32) + #define CALLBACK __stdcall + #define GLFW_CALLBACK_DEFINED +#endif /* CALLBACK */ + +/* Include the chosen OpenGL or OpenGL ES headers. + */ +#if defined(GLFW_INCLUDE_ES1) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES2) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES3) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES31) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_ES32) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + +#elif defined(GLFW_INCLUDE_GLCOREARB) + + #if defined(__APPLE__) + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif /*GLFW_INCLUDE_GLEXT*/ + + #else /*__APPLE__*/ + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + + #endif /*__APPLE__*/ + +#elif defined(GLFW_INCLUDE_GLU) + + #if defined(__APPLE__) + + #if defined(GLFW_INCLUDE_GLU) + #include + #endif + + #else /*__APPLE__*/ + + #if defined(GLFW_INCLUDE_GLU) + #include + #endif + + #endif /*__APPLE__*/ + +#elif !defined(GLFW_INCLUDE_NONE) && \ + !defined(__gl_h_) && \ + !defined(__gles1_gl_h_) && \ + !defined(__gles2_gl2_h_) && \ + !defined(__gles2_gl3_h_) && \ + !defined(__gles2_gl31_h_) && \ + !defined(__gles2_gl32_h_) && \ + !defined(__gl_glcorearb_h_) && \ + !defined(__gl2_h_) /*legacy*/ && \ + !defined(__gl3_h_) /*legacy*/ && \ + !defined(__gl31_h_) /*legacy*/ && \ + !defined(__gl32_h_) /*legacy*/ && \ + !defined(__glcorearb_h_) /*legacy*/ && \ + !defined(__GL_H__) /*non-standard*/ && \ + !defined(__gltypes_h_) /*non-standard*/ && \ + !defined(__glee_h_) /*non-standard*/ + + #if defined(__APPLE__) + + #if !defined(GLFW_INCLUDE_GLEXT) + #define GL_GLEXT_LEGACY + #endif + #include + + #else /*__APPLE__*/ + + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + + #endif /*__APPLE__*/ + +#endif /* OpenGL and OpenGL ES headers */ + +#if defined(GLFW_DLL) && defined(_GLFW_BUILD_DLL) + /* GLFW_DLL must be defined by applications that are linking against the DLL + * version of the GLFW library. _GLFW_BUILD_DLL is defined by the GLFW + * configuration header when compiling the DLL version of the library. + */ + #error "You must not have both GLFW_DLL and _GLFW_BUILD_DLL defined" +#endif + +/* GLFWAPI is used to declare public API functions for export + * from the DLL / shared library / dynamic library. + */ +#if defined(_WIN32) && defined(_GLFW_BUILD_DLL) + /* We are building GLFW as a Win32 DLL */ + #define GLFWAPI __declspec(dllexport) +#elif defined(_WIN32) && defined(GLFW_DLL) + /* We are calling a GLFW Win32 DLL */ + #define GLFWAPI __declspec(dllimport) +#elif defined(__GNUC__) && defined(_GLFW_BUILD_DLL) + /* We are building GLFW as a Unix shared library */ + #define GLFWAPI __attribute__((visibility("default"))) +#else + #define GLFWAPI +#endif + + +/************************************************************************* + * GLFW API tokens + *************************************************************************/ + +/*! @name GLFW version macros + * @{ */ +/*! @brief The major version number of the GLFW header. + * + * The major version number of the GLFW header. This is incremented when the + * API is changed in non-compatible ways. + * @ingroup init + */ +#define GLFW_VERSION_MAJOR 3 +/*! @brief The minor version number of the GLFW header. + * + * The minor version number of the GLFW header. This is incremented when + * features are added to the API but it remains backward-compatible. + * @ingroup init + */ +#define GLFW_VERSION_MINOR 4 +/*! @brief The revision number of the GLFW header. + * + * The revision number of the GLFW header. This is incremented when a bug fix + * release is made that does not contain any API changes. + * @ingroup init + */ +#define GLFW_VERSION_REVISION 0 +/*! @} */ + +/*! @brief One. + * + * This is only semantic sugar for the number 1. You can instead use `1` or + * `true` or `_True` or `GL_TRUE` or `VK_TRUE` or anything else that is equal + * to one. + * + * @ingroup init + */ +#define GLFW_TRUE 1 +/*! @brief Zero. + * + * This is only semantic sugar for the number 0. You can instead use `0` or + * `false` or `_False` or `GL_FALSE` or `VK_FALSE` or anything else that is + * equal to zero. + * + * @ingroup init + */ +#define GLFW_FALSE 0 + +/*! @name Key and button actions + * @{ */ +/*! @brief The key or mouse button was released. + * + * The key or mouse button was released. + * + * @ingroup input + */ +#define GLFW_RELEASE 0 +/*! @brief The key or mouse button was pressed. + * + * The key or mouse button was pressed. + * + * @ingroup input + */ +#define GLFW_PRESS 1 +/*! @brief The key was held down until it repeated. + * + * The key was held down until it repeated. + * + * @ingroup input + */ +#define GLFW_REPEAT 2 +/*! @} */ + +/*! @defgroup hat_state Joystick hat states + * @brief Joystick hat states. + * + * See [joystick hat input](@ref joystick_hat) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_HAT_CENTERED 0 +#define GLFW_HAT_UP 1 +#define GLFW_HAT_RIGHT 2 +#define GLFW_HAT_DOWN 4 +#define GLFW_HAT_LEFT 8 +#define GLFW_HAT_RIGHT_UP (GLFW_HAT_RIGHT | GLFW_HAT_UP) +#define GLFW_HAT_RIGHT_DOWN (GLFW_HAT_RIGHT | GLFW_HAT_DOWN) +#define GLFW_HAT_LEFT_UP (GLFW_HAT_LEFT | GLFW_HAT_UP) +#define GLFW_HAT_LEFT_DOWN (GLFW_HAT_LEFT | GLFW_HAT_DOWN) + +/*! @ingroup input + */ +#define GLFW_KEY_UNKNOWN -1 + +/*! @} */ + +/*! @defgroup keys Keyboard key tokens + * @brief Keyboard key tokens. + * + * See [key input](@ref input_key) for how these are used. + * + * These key codes are inspired by the _USB HID Usage Tables v1.12_ (p. 53-60), + * but re-arranged to map to 7-bit ASCII for printable keys (function keys are + * put in the 256+ range). + * + * The naming of the key codes follow these rules: + * - The US keyboard layout is used + * - Names of printable alphanumeric characters are used (e.g. "A", "R", + * "3", etc.) + * - For non-alphanumeric characters, Unicode:ish names are used (e.g. + * "COMMA", "LEFT_SQUARE_BRACKET", etc.). Note that some names do not + * correspond to the Unicode standard (usually for brevity) + * - Keys that lack a clear US mapping are named "WORLD_x" + * - For non-printable keys, custom names are used (e.g. "F4", + * "BACKSPACE", etc.) + * + * @ingroup input + * @{ + */ + +/* Printable keys */ +#define GLFW_KEY_SPACE 32 +#define GLFW_KEY_APOSTROPHE 39 /* ' */ +#define GLFW_KEY_COMMA 44 /* , */ +#define GLFW_KEY_MINUS 45 /* - */ +#define GLFW_KEY_PERIOD 46 /* . */ +#define GLFW_KEY_SLASH 47 /* / */ +#define GLFW_KEY_0 48 +#define GLFW_KEY_1 49 +#define GLFW_KEY_2 50 +#define GLFW_KEY_3 51 +#define GLFW_KEY_4 52 +#define GLFW_KEY_5 53 +#define GLFW_KEY_6 54 +#define GLFW_KEY_7 55 +#define GLFW_KEY_8 56 +#define GLFW_KEY_9 57 +#define GLFW_KEY_SEMICOLON 59 /* ; */ +#define GLFW_KEY_EQUAL 61 /* = */ +#define GLFW_KEY_A 65 +#define GLFW_KEY_B 66 +#define GLFW_KEY_C 67 +#define GLFW_KEY_D 68 +#define GLFW_KEY_E 69 +#define GLFW_KEY_F 70 +#define GLFW_KEY_G 71 +#define GLFW_KEY_H 72 +#define GLFW_KEY_I 73 +#define GLFW_KEY_J 74 +#define GLFW_KEY_K 75 +#define GLFW_KEY_L 76 +#define GLFW_KEY_M 77 +#define GLFW_KEY_N 78 +#define GLFW_KEY_O 79 +#define GLFW_KEY_P 80 +#define GLFW_KEY_Q 81 +#define GLFW_KEY_R 82 +#define GLFW_KEY_S 83 +#define GLFW_KEY_T 84 +#define GLFW_KEY_U 85 +#define GLFW_KEY_V 86 +#define GLFW_KEY_W 87 +#define GLFW_KEY_X 88 +#define GLFW_KEY_Y 89 +#define GLFW_KEY_Z 90 +#define GLFW_KEY_LEFT_BRACKET 91 /* [ */ +#define GLFW_KEY_BACKSLASH 92 /* \ */ +#define GLFW_KEY_RIGHT_BRACKET 93 /* ] */ +#define GLFW_KEY_GRAVE_ACCENT 96 /* ` */ +#define GLFW_KEY_WORLD_1 161 /* non-US #1 */ +#define GLFW_KEY_WORLD_2 162 /* non-US #2 */ + +/* Function keys */ +#define GLFW_KEY_ESCAPE 256 +#define GLFW_KEY_ENTER 257 +#define GLFW_KEY_TAB 258 +#define GLFW_KEY_BACKSPACE 259 +#define GLFW_KEY_INSERT 260 +#define GLFW_KEY_DELETE 261 +#define GLFW_KEY_RIGHT 262 +#define GLFW_KEY_LEFT 263 +#define GLFW_KEY_DOWN 264 +#define GLFW_KEY_UP 265 +#define GLFW_KEY_PAGE_UP 266 +#define GLFW_KEY_PAGE_DOWN 267 +#define GLFW_KEY_HOME 268 +#define GLFW_KEY_END 269 +#define GLFW_KEY_CAPS_LOCK 280 +#define GLFW_KEY_SCROLL_LOCK 281 +#define GLFW_KEY_NUM_LOCK 282 +#define GLFW_KEY_PRINT_SCREEN 283 +#define GLFW_KEY_PAUSE 284 +#define GLFW_KEY_F1 290 +#define GLFW_KEY_F2 291 +#define GLFW_KEY_F3 292 +#define GLFW_KEY_F4 293 +#define GLFW_KEY_F5 294 +#define GLFW_KEY_F6 295 +#define GLFW_KEY_F7 296 +#define GLFW_KEY_F8 297 +#define GLFW_KEY_F9 298 +#define GLFW_KEY_F10 299 +#define GLFW_KEY_F11 300 +#define GLFW_KEY_F12 301 +#define GLFW_KEY_F13 302 +#define GLFW_KEY_F14 303 +#define GLFW_KEY_F15 304 +#define GLFW_KEY_F16 305 +#define GLFW_KEY_F17 306 +#define GLFW_KEY_F18 307 +#define GLFW_KEY_F19 308 +#define GLFW_KEY_F20 309 +#define GLFW_KEY_F21 310 +#define GLFW_KEY_F22 311 +#define GLFW_KEY_F23 312 +#define GLFW_KEY_F24 313 +#define GLFW_KEY_F25 314 +#define GLFW_KEY_KP_0 320 +#define GLFW_KEY_KP_1 321 +#define GLFW_KEY_KP_2 322 +#define GLFW_KEY_KP_3 323 +#define GLFW_KEY_KP_4 324 +#define GLFW_KEY_KP_5 325 +#define GLFW_KEY_KP_6 326 +#define GLFW_KEY_KP_7 327 +#define GLFW_KEY_KP_8 328 +#define GLFW_KEY_KP_9 329 +#define GLFW_KEY_KP_DECIMAL 330 +#define GLFW_KEY_KP_DIVIDE 331 +#define GLFW_KEY_KP_MULTIPLY 332 +#define GLFW_KEY_KP_SUBTRACT 333 +#define GLFW_KEY_KP_ADD 334 +#define GLFW_KEY_KP_ENTER 335 +#define GLFW_KEY_KP_EQUAL 336 +#define GLFW_KEY_LEFT_SHIFT 340 +#define GLFW_KEY_LEFT_CONTROL 341 +#define GLFW_KEY_LEFT_ALT 342 +#define GLFW_KEY_LEFT_SUPER 343 +#define GLFW_KEY_RIGHT_SHIFT 344 +#define GLFW_KEY_RIGHT_CONTROL 345 +#define GLFW_KEY_RIGHT_ALT 346 +#define GLFW_KEY_RIGHT_SUPER 347 +#define GLFW_KEY_MENU 348 + +#define GLFW_KEY_LAST GLFW_KEY_MENU + +/*! @} */ + +/*! @defgroup mods Modifier key flags + * @brief Modifier key flags. + * + * See [key input](@ref input_key) for how these are used. + * + * @ingroup input + * @{ */ + +/*! @brief If this bit is set one or more Shift keys were held down. + * + * If this bit is set one or more Shift keys were held down. + */ +#define GLFW_MOD_SHIFT 0x0001 +/*! @brief If this bit is set one or more Control keys were held down. + * + * If this bit is set one or more Control keys were held down. + */ +#define GLFW_MOD_CONTROL 0x0002 +/*! @brief If this bit is set one or more Alt keys were held down. + * + * If this bit is set one or more Alt keys were held down. + */ +#define GLFW_MOD_ALT 0x0004 +/*! @brief If this bit is set one or more Super keys were held down. + * + * If this bit is set one or more Super keys were held down. + */ +#define GLFW_MOD_SUPER 0x0008 +/*! @brief If this bit is set the Caps Lock key is enabled. + * + * If this bit is set the Caps Lock key is enabled and the @ref + * GLFW_LOCK_KEY_MODS input mode is set. + */ +#define GLFW_MOD_CAPS_LOCK 0x0010 +/*! @brief If this bit is set the Num Lock key is enabled. + * + * If this bit is set the Num Lock key is enabled and the @ref + * GLFW_LOCK_KEY_MODS input mode is set. + */ +#define GLFW_MOD_NUM_LOCK 0x0020 + +/*! @} */ + +/*! @defgroup buttons Mouse buttons + * @brief Mouse button IDs. + * + * See [mouse button input](@ref input_mouse_button) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_MOUSE_BUTTON_1 0 +#define GLFW_MOUSE_BUTTON_2 1 +#define GLFW_MOUSE_BUTTON_3 2 +#define GLFW_MOUSE_BUTTON_4 3 +#define GLFW_MOUSE_BUTTON_5 4 +#define GLFW_MOUSE_BUTTON_6 5 +#define GLFW_MOUSE_BUTTON_7 6 +#define GLFW_MOUSE_BUTTON_8 7 +#define GLFW_MOUSE_BUTTON_LAST GLFW_MOUSE_BUTTON_8 +#define GLFW_MOUSE_BUTTON_LEFT GLFW_MOUSE_BUTTON_1 +#define GLFW_MOUSE_BUTTON_RIGHT GLFW_MOUSE_BUTTON_2 +#define GLFW_MOUSE_BUTTON_MIDDLE GLFW_MOUSE_BUTTON_3 +/*! @} */ + +/*! @defgroup joysticks Joysticks + * @brief Joystick IDs. + * + * See [joystick input](@ref joystick) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_JOYSTICK_1 0 +#define GLFW_JOYSTICK_2 1 +#define GLFW_JOYSTICK_3 2 +#define GLFW_JOYSTICK_4 3 +#define GLFW_JOYSTICK_5 4 +#define GLFW_JOYSTICK_6 5 +#define GLFW_JOYSTICK_7 6 +#define GLFW_JOYSTICK_8 7 +#define GLFW_JOYSTICK_9 8 +#define GLFW_JOYSTICK_10 9 +#define GLFW_JOYSTICK_11 10 +#define GLFW_JOYSTICK_12 11 +#define GLFW_JOYSTICK_13 12 +#define GLFW_JOYSTICK_14 13 +#define GLFW_JOYSTICK_15 14 +#define GLFW_JOYSTICK_16 15 +#define GLFW_JOYSTICK_LAST GLFW_JOYSTICK_16 +/*! @} */ + +/*! @defgroup gamepad_buttons Gamepad buttons + * @brief Gamepad buttons. + * + * See @ref gamepad for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_GAMEPAD_BUTTON_A 0 +#define GLFW_GAMEPAD_BUTTON_B 1 +#define GLFW_GAMEPAD_BUTTON_X 2 +#define GLFW_GAMEPAD_BUTTON_Y 3 +#define GLFW_GAMEPAD_BUTTON_LEFT_BUMPER 4 +#define GLFW_GAMEPAD_BUTTON_RIGHT_BUMPER 5 +#define GLFW_GAMEPAD_BUTTON_BACK 6 +#define GLFW_GAMEPAD_BUTTON_START 7 +#define GLFW_GAMEPAD_BUTTON_GUIDE 8 +#define GLFW_GAMEPAD_BUTTON_LEFT_THUMB 9 +#define GLFW_GAMEPAD_BUTTON_RIGHT_THUMB 10 +#define GLFW_GAMEPAD_BUTTON_DPAD_UP 11 +#define GLFW_GAMEPAD_BUTTON_DPAD_RIGHT 12 +#define GLFW_GAMEPAD_BUTTON_DPAD_DOWN 13 +#define GLFW_GAMEPAD_BUTTON_DPAD_LEFT 14 +#define GLFW_GAMEPAD_BUTTON_LAST GLFW_GAMEPAD_BUTTON_DPAD_LEFT + +#define GLFW_GAMEPAD_BUTTON_CROSS GLFW_GAMEPAD_BUTTON_A +#define GLFW_GAMEPAD_BUTTON_CIRCLE GLFW_GAMEPAD_BUTTON_B +#define GLFW_GAMEPAD_BUTTON_SQUARE GLFW_GAMEPAD_BUTTON_X +#define GLFW_GAMEPAD_BUTTON_TRIANGLE GLFW_GAMEPAD_BUTTON_Y +/*! @} */ + +/*! @defgroup gamepad_axes Gamepad axes + * @brief Gamepad axes. + * + * See @ref gamepad for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_GAMEPAD_AXIS_LEFT_X 0 +#define GLFW_GAMEPAD_AXIS_LEFT_Y 1 +#define GLFW_GAMEPAD_AXIS_RIGHT_X 2 +#define GLFW_GAMEPAD_AXIS_RIGHT_Y 3 +#define GLFW_GAMEPAD_AXIS_LEFT_TRIGGER 4 +#define GLFW_GAMEPAD_AXIS_RIGHT_TRIGGER 5 +#define GLFW_GAMEPAD_AXIS_LAST GLFW_GAMEPAD_AXIS_RIGHT_TRIGGER +/*! @} */ + +/*! @defgroup errors Error codes + * @brief Error codes. + * + * See [error handling](@ref error_handling) for how these are used. + * + * @ingroup init + * @{ */ +/*! @brief No error has occurred. + * + * No error has occurred. + * + * @analysis Yay. + */ +#define GLFW_NO_ERROR 0 +/*! @brief GLFW has not been initialized. + * + * This occurs if a GLFW function was called that must not be called unless the + * library is [initialized](@ref intro_init). + * + * @analysis Application programmer error. Initialize GLFW before calling any + * function that requires initialization. + */ +#define GLFW_NOT_INITIALIZED 0x00010001 +/*! @brief No context is current for this thread. + * + * This occurs if a GLFW function was called that needs and operates on the + * current OpenGL or OpenGL ES context but no context is current on the calling + * thread. One such function is @ref glfwSwapInterval. + * + * @analysis Application programmer error. Ensure a context is current before + * calling functions that require a current context. + */ +#define GLFW_NO_CURRENT_CONTEXT 0x00010002 +/*! @brief One of the arguments to the function was an invalid enum value. + * + * One of the arguments to the function was an invalid enum value, for example + * requesting @ref GLFW_RED_BITS with @ref glfwGetWindowAttrib. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_INVALID_ENUM 0x00010003 +/*! @brief One of the arguments to the function was an invalid value. + * + * One of the arguments to the function was an invalid value, for example + * requesting a non-existent OpenGL or OpenGL ES version like 2.7. + * + * Requesting a valid but unavailable OpenGL or OpenGL ES version will instead + * result in a @ref GLFW_VERSION_UNAVAILABLE error. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_INVALID_VALUE 0x00010004 +/*! @brief A memory allocation failed. + * + * A memory allocation failed. + * + * @analysis A bug in GLFW or the underlying operating system. Report the bug + * to our [issue tracker](https://github.com/glfw/glfw/issues). + */ +#define GLFW_OUT_OF_MEMORY 0x00010005 +/*! @brief GLFW could not find support for the requested API on the system. + * + * GLFW could not find support for the requested API on the system. + * + * @analysis The installed graphics driver does not support the requested + * API, or does not support it via the chosen context creation API. + * Below are a few examples. + * + * @par + * Some pre-installed Windows graphics drivers do not support OpenGL. AMD only + * supports OpenGL ES via EGL, while Nvidia and Intel only support it via + * a WGL or GLX extension. macOS does not provide OpenGL ES at all. The Mesa + * EGL, OpenGL and OpenGL ES libraries do not interface with the Nvidia binary + * driver. Older graphics drivers do not support Vulkan. + */ +#define GLFW_API_UNAVAILABLE 0x00010006 +/*! @brief The requested OpenGL or OpenGL ES version is not available. + * + * The requested OpenGL or OpenGL ES version (including any requested context + * or framebuffer hints) is not available on this machine. + * + * @analysis The machine does not support your requirements. If your + * application is sufficiently flexible, downgrade your requirements and try + * again. Otherwise, inform the user that their machine does not match your + * requirements. + * + * @par + * Future invalid OpenGL and OpenGL ES versions, for example OpenGL 4.8 if 5.0 + * comes out before the 4.x series gets that far, also fail with this error and + * not @ref GLFW_INVALID_VALUE, because GLFW cannot know what future versions + * will exist. + */ +#define GLFW_VERSION_UNAVAILABLE 0x00010007 +/*! @brief A platform-specific error occurred that does not match any of the + * more specific categories. + * + * A platform-specific error occurred that does not match any of the more + * specific categories. + * + * @analysis A bug or configuration error in GLFW, the underlying operating + * system or its drivers, or a lack of required resources. Report the issue to + * our [issue tracker](https://github.com/glfw/glfw/issues). + */ +#define GLFW_PLATFORM_ERROR 0x00010008 +/*! @brief The requested format is not supported or available. + * + * If emitted during window creation, the requested pixel format is not + * supported. + * + * If emitted when querying the clipboard, the contents of the clipboard could + * not be converted to the requested format. + * + * @analysis If emitted during window creation, one or more + * [hard constraints](@ref window_hints_hard) did not match any of the + * available pixel formats. If your application is sufficiently flexible, + * downgrade your requirements and try again. Otherwise, inform the user that + * their machine does not match your requirements. + * + * @par + * If emitted when querying the clipboard, ignore the error or report it to + * the user, as appropriate. + */ +#define GLFW_FORMAT_UNAVAILABLE 0x00010009 +/*! @brief The specified window does not have an OpenGL or OpenGL ES context. + * + * A window that does not have an OpenGL or OpenGL ES context was passed to + * a function that requires it to have one. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_NO_WINDOW_CONTEXT 0x0001000A +/*! @brief The specified cursor shape is not available. + * + * The specified standard cursor shape is not available, either because the + * current platform cursor theme does not provide it or because it is not + * available on the platform. + * + * @analysis Platform or system settings limitation. Pick another + * [standard cursor shape](@ref shapes) or create a + * [custom cursor](@ref cursor_custom). + */ +#define GLFW_CURSOR_UNAVAILABLE 0x0001000B +/*! @brief The requested feature is not provided by the platform. + * + * The requested feature is not provided by the platform, so GLFW is unable to + * implement it. The documentation for each function notes if it could emit + * this error. + * + * @analysis Platform or platform version limitation. The error can be ignored + * unless the feature is critical to the application. + * + * @par + * A function call that emits this error has no effect other than the error and + * updating any existing out parameters. + */ +#define GLFW_FEATURE_UNAVAILABLE 0x0001000C +/*! @brief The requested feature is not implemented for the platform. + * + * The requested feature has not yet been implemented in GLFW for this platform. + * + * @analysis An incomplete implementation of GLFW for this platform, hopefully + * fixed in a future release. The error can be ignored unless the feature is + * critical to the application. + * + * @par + * A function call that emits this error has no effect other than the error and + * updating any existing out parameters. + */ +#define GLFW_FEATURE_UNIMPLEMENTED 0x0001000D +/*! @brief Platform unavailable or no matching platform was found. + * + * If emitted during initialization, no matching platform was found. If the @ref + * GLFW_PLATFORM init hint was set to `GLFW_ANY_PLATFORM`, GLFW could not detect any of + * the platforms supported by this library binary, except for the Null platform. If the + * init hint was set to a specific platform, it is either not supported by this library + * binary or GLFW was not able to detect it. + * + * If emitted by a native access function, GLFW was initialized for a different platform + * than the function is for. + * + * @analysis Failure to detect any platform usually only happens on non-macOS Unix + * systems, either when no window system is running or the program was run from + * a terminal that does not have the necessary environment variables. Fall back to + * a different platform if possible or notify the user that no usable platform was + * detected. + * + * Failure to detect a specific platform may have the same cause as above or be because + * support for that platform was not compiled in. Call @ref glfwPlatformSupported to + * check whether a specific platform is supported by a library binary. + */ +#define GLFW_PLATFORM_UNAVAILABLE 0x0001000E +/*! @} */ + +/*! @addtogroup window + * @{ */ +/*! @brief Input focus window hint and attribute + * + * Input focus [window hint](@ref GLFW_FOCUSED_hint) or + * [window attribute](@ref GLFW_FOCUSED_attrib). + */ +#define GLFW_FOCUSED 0x00020001 +/*! @brief Window iconification window attribute + * + * Window iconification [window attribute](@ref GLFW_ICONIFIED_attrib). + */ +#define GLFW_ICONIFIED 0x00020002 +/*! @brief Window resize-ability window hint and attribute + * + * Window resize-ability [window hint](@ref GLFW_RESIZABLE_hint) and + * [window attribute](@ref GLFW_RESIZABLE_attrib). + */ +#define GLFW_RESIZABLE 0x00020003 +/*! @brief Window visibility window hint and attribute + * + * Window visibility [window hint](@ref GLFW_VISIBLE_hint) and + * [window attribute](@ref GLFW_VISIBLE_attrib). + */ +#define GLFW_VISIBLE 0x00020004 +/*! @brief Window decoration window hint and attribute + * + * Window decoration [window hint](@ref GLFW_DECORATED_hint) and + * [window attribute](@ref GLFW_DECORATED_attrib). + */ +#define GLFW_DECORATED 0x00020005 +/*! @brief Window auto-iconification window hint and attribute + * + * Window auto-iconification [window hint](@ref GLFW_AUTO_ICONIFY_hint) and + * [window attribute](@ref GLFW_AUTO_ICONIFY_attrib). + */ +#define GLFW_AUTO_ICONIFY 0x00020006 +/*! @brief Window decoration window hint and attribute + * + * Window decoration [window hint](@ref GLFW_FLOATING_hint) and + * [window attribute](@ref GLFW_FLOATING_attrib). + */ +#define GLFW_FLOATING 0x00020007 +/*! @brief Window maximization window hint and attribute + * + * Window maximization [window hint](@ref GLFW_MAXIMIZED_hint) and + * [window attribute](@ref GLFW_MAXIMIZED_attrib). + */ +#define GLFW_MAXIMIZED 0x00020008 +/*! @brief Cursor centering window hint + * + * Cursor centering [window hint](@ref GLFW_CENTER_CURSOR_hint). + */ +#define GLFW_CENTER_CURSOR 0x00020009 +/*! @brief Window framebuffer transparency hint and attribute + * + * Window framebuffer transparency + * [window hint](@ref GLFW_TRANSPARENT_FRAMEBUFFER_hint) and + * [window attribute](@ref GLFW_TRANSPARENT_FRAMEBUFFER_attrib). + */ +#define GLFW_TRANSPARENT_FRAMEBUFFER 0x0002000A +/*! @brief Mouse cursor hover window attribute. + * + * Mouse cursor hover [window attribute](@ref GLFW_HOVERED_attrib). + */ +#define GLFW_HOVERED 0x0002000B +/*! @brief Input focus on calling show window hint and attribute + * + * Input focus [window hint](@ref GLFW_FOCUS_ON_SHOW_hint) or + * [window attribute](@ref GLFW_FOCUS_ON_SHOW_attrib). + */ +#define GLFW_FOCUS_ON_SHOW 0x0002000C + +/*! @brief Mouse input transparency window hint and attribute + * + * Mouse input transparency [window hint](@ref GLFW_MOUSE_PASSTHROUGH_hint) or + * [window attribute](@ref GLFW_MOUSE_PASSTHROUGH_attrib). + */ +#define GLFW_MOUSE_PASSTHROUGH 0x0002000D + +/*! @brief Initial position x-coordinate window hint. + * + * Initial position x-coordinate [window hint](@ref GLFW_POSITION_X). + */ +#define GLFW_POSITION_X 0x0002000E + +/*! @brief Initial position y-coordinate window hint. + * + * Initial position y-coordinate [window hint](@ref GLFW_POSITION_Y). + */ +#define GLFW_POSITION_Y 0x0002000F + +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_RED_BITS). + */ +#define GLFW_RED_BITS 0x00021001 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_GREEN_BITS). + */ +#define GLFW_GREEN_BITS 0x00021002 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_BLUE_BITS). + */ +#define GLFW_BLUE_BITS 0x00021003 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ALPHA_BITS). + */ +#define GLFW_ALPHA_BITS 0x00021004 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_DEPTH_BITS). + */ +#define GLFW_DEPTH_BITS 0x00021005 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_STENCIL_BITS). + */ +#define GLFW_STENCIL_BITS 0x00021006 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_RED_BITS). + */ +#define GLFW_ACCUM_RED_BITS 0x00021007 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_GREEN_BITS). + */ +#define GLFW_ACCUM_GREEN_BITS 0x00021008 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_BLUE_BITS). + */ +#define GLFW_ACCUM_BLUE_BITS 0x00021009 +/*! @brief Framebuffer bit depth hint. + * + * Framebuffer bit depth [hint](@ref GLFW_ACCUM_ALPHA_BITS). + */ +#define GLFW_ACCUM_ALPHA_BITS 0x0002100A +/*! @brief Framebuffer auxiliary buffer hint. + * + * Framebuffer auxiliary buffer [hint](@ref GLFW_AUX_BUFFERS). + */ +#define GLFW_AUX_BUFFERS 0x0002100B +/*! @brief OpenGL stereoscopic rendering hint. + * + * OpenGL stereoscopic rendering [hint](@ref GLFW_STEREO). + */ +#define GLFW_STEREO 0x0002100C +/*! @brief Framebuffer MSAA samples hint. + * + * Framebuffer MSAA samples [hint](@ref GLFW_SAMPLES). + */ +#define GLFW_SAMPLES 0x0002100D +/*! @brief Framebuffer sRGB hint. + * + * Framebuffer sRGB [hint](@ref GLFW_SRGB_CAPABLE). + */ +#define GLFW_SRGB_CAPABLE 0x0002100E +/*! @brief Monitor refresh rate hint. + * + * Monitor refresh rate [hint](@ref GLFW_REFRESH_RATE). + */ +#define GLFW_REFRESH_RATE 0x0002100F +/*! @brief Framebuffer double buffering hint and attribute. + * + * Framebuffer double buffering [hint](@ref GLFW_DOUBLEBUFFER_hint) and + * [attribute](@ref GLFW_DOUBLEBUFFER_attrib). + */ +#define GLFW_DOUBLEBUFFER 0x00021010 + +/*! @brief Context client API hint and attribute. + * + * Context client API [hint](@ref GLFW_CLIENT_API_hint) and + * [attribute](@ref GLFW_CLIENT_API_attrib). + */ +#define GLFW_CLIENT_API 0x00022001 +/*! @brief Context client API major version hint and attribute. + * + * Context client API major version [hint](@ref GLFW_CONTEXT_VERSION_MAJOR_hint) + * and [attribute](@ref GLFW_CONTEXT_VERSION_MAJOR_attrib). + */ +#define GLFW_CONTEXT_VERSION_MAJOR 0x00022002 +/*! @brief Context client API minor version hint and attribute. + * + * Context client API minor version [hint](@ref GLFW_CONTEXT_VERSION_MINOR_hint) + * and [attribute](@ref GLFW_CONTEXT_VERSION_MINOR_attrib). + */ +#define GLFW_CONTEXT_VERSION_MINOR 0x00022003 +/*! @brief Context client API revision number attribute. + * + * Context client API revision number + * [attribute](@ref GLFW_CONTEXT_REVISION_attrib). + */ +#define GLFW_CONTEXT_REVISION 0x00022004 +/*! @brief Context robustness hint and attribute. + * + * Context client API revision number [hint](@ref GLFW_CONTEXT_ROBUSTNESS_hint) + * and [attribute](@ref GLFW_CONTEXT_ROBUSTNESS_attrib). + */ +#define GLFW_CONTEXT_ROBUSTNESS 0x00022005 +/*! @brief OpenGL forward-compatibility hint and attribute. + * + * OpenGL forward-compatibility [hint](@ref GLFW_OPENGL_FORWARD_COMPAT_hint) + * and [attribute](@ref GLFW_OPENGL_FORWARD_COMPAT_attrib). + */ +#define GLFW_OPENGL_FORWARD_COMPAT 0x00022006 +/*! @brief Debug mode context hint and attribute. + * + * Debug mode context [hint](@ref GLFW_CONTEXT_DEBUG_hint) and + * [attribute](@ref GLFW_CONTEXT_DEBUG_attrib). + */ +#define GLFW_CONTEXT_DEBUG 0x00022007 +/*! @brief Legacy name for compatibility. + * + * This is an alias for compatibility with earlier versions. + */ +#define GLFW_OPENGL_DEBUG_CONTEXT GLFW_CONTEXT_DEBUG +/*! @brief OpenGL profile hint and attribute. + * + * OpenGL profile [hint](@ref GLFW_OPENGL_PROFILE_hint) and + * [attribute](@ref GLFW_OPENGL_PROFILE_attrib). + */ +#define GLFW_OPENGL_PROFILE 0x00022008 +/*! @brief Context flush-on-release hint and attribute. + * + * Context flush-on-release [hint](@ref GLFW_CONTEXT_RELEASE_BEHAVIOR_hint) and + * [attribute](@ref GLFW_CONTEXT_RELEASE_BEHAVIOR_attrib). + */ +#define GLFW_CONTEXT_RELEASE_BEHAVIOR 0x00022009 +/*! @brief Context error suppression hint and attribute. + * + * Context error suppression [hint](@ref GLFW_CONTEXT_NO_ERROR_hint) and + * [attribute](@ref GLFW_CONTEXT_NO_ERROR_attrib). + */ +#define GLFW_CONTEXT_NO_ERROR 0x0002200A +/*! @brief Context creation API hint and attribute. + * + * Context creation API [hint](@ref GLFW_CONTEXT_CREATION_API_hint) and + * [attribute](@ref GLFW_CONTEXT_CREATION_API_attrib). + */ +#define GLFW_CONTEXT_CREATION_API 0x0002200B +/*! @brief Window content area scaling window + * [window hint](@ref GLFW_SCALE_TO_MONITOR). + */ +#define GLFW_SCALE_TO_MONITOR 0x0002200C +/*! @brief Window framebuffer scaling + * [window hint](@ref GLFW_SCALE_FRAMEBUFFER_hint). + */ +#define GLFW_SCALE_FRAMEBUFFER 0x0002200D +/*! @brief Legacy name for compatibility. + * + * This is an alias for the + * [GLFW_SCALE_FRAMEBUFFER](@ref GLFW_SCALE_FRAMEBUFFER_hint) window hint for + * compatibility with earlier versions. + */ +#define GLFW_COCOA_RETINA_FRAMEBUFFER 0x00023001 +/*! @brief macOS specific + * [window hint](@ref GLFW_COCOA_FRAME_NAME_hint). + */ +#define GLFW_COCOA_FRAME_NAME 0x00023002 +/*! @brief macOS specific + * [window hint](@ref GLFW_COCOA_GRAPHICS_SWITCHING_hint). + */ +#define GLFW_COCOA_GRAPHICS_SWITCHING 0x00023003 +/*! @brief X11 specific + * [window hint](@ref GLFW_X11_CLASS_NAME_hint). + */ +#define GLFW_X11_CLASS_NAME 0x00024001 +/*! @brief X11 specific + * [window hint](@ref GLFW_X11_CLASS_NAME_hint). + */ +#define GLFW_X11_INSTANCE_NAME 0x00024002 +#define GLFW_WIN32_KEYBOARD_MENU 0x00025001 +/*! @brief Win32 specific [window hint](@ref GLFW_WIN32_SHOWDEFAULT_hint). + */ +#define GLFW_WIN32_SHOWDEFAULT 0x00025002 +/*! @brief Wayland specific + * [window hint](@ref GLFW_WAYLAND_APP_ID_hint). + * + * Allows specification of the Wayland app_id. + */ +#define GLFW_WAYLAND_APP_ID 0x00026001 +/*! @} */ + +#define GLFW_NO_API 0 +#define GLFW_OPENGL_API 0x00030001 +#define GLFW_OPENGL_ES_API 0x00030002 + +#define GLFW_NO_ROBUSTNESS 0 +#define GLFW_NO_RESET_NOTIFICATION 0x00031001 +#define GLFW_LOSE_CONTEXT_ON_RESET 0x00031002 + +#define GLFW_OPENGL_ANY_PROFILE 0 +#define GLFW_OPENGL_CORE_PROFILE 0x00032001 +#define GLFW_OPENGL_COMPAT_PROFILE 0x00032002 + +#define GLFW_CURSOR 0x00033001 +#define GLFW_STICKY_KEYS 0x00033002 +#define GLFW_STICKY_MOUSE_BUTTONS 0x00033003 +#define GLFW_LOCK_KEY_MODS 0x00033004 +#define GLFW_RAW_MOUSE_MOTION 0x00033005 + +#define GLFW_CURSOR_NORMAL 0x00034001 +#define GLFW_CURSOR_HIDDEN 0x00034002 +#define GLFW_CURSOR_DISABLED 0x00034003 +#define GLFW_CURSOR_CAPTURED 0x00034004 + +#define GLFW_ANY_RELEASE_BEHAVIOR 0 +#define GLFW_RELEASE_BEHAVIOR_FLUSH 0x00035001 +#define GLFW_RELEASE_BEHAVIOR_NONE 0x00035002 + +#define GLFW_NATIVE_CONTEXT_API 0x00036001 +#define GLFW_EGL_CONTEXT_API 0x00036002 +#define GLFW_OSMESA_CONTEXT_API 0x00036003 + +#define GLFW_ANGLE_PLATFORM_TYPE_NONE 0x00037001 +#define GLFW_ANGLE_PLATFORM_TYPE_OPENGL 0x00037002 +#define GLFW_ANGLE_PLATFORM_TYPE_OPENGLES 0x00037003 +#define GLFW_ANGLE_PLATFORM_TYPE_D3D9 0x00037004 +#define GLFW_ANGLE_PLATFORM_TYPE_D3D11 0x00037005 +#define GLFW_ANGLE_PLATFORM_TYPE_VULKAN 0x00037007 +#define GLFW_ANGLE_PLATFORM_TYPE_METAL 0x00037008 + +#define GLFW_WAYLAND_PREFER_LIBDECOR 0x00038001 +#define GLFW_WAYLAND_DISABLE_LIBDECOR 0x00038002 + +#define GLFW_ANY_POSITION 0x80000000 + +/*! @defgroup shapes Standard cursor shapes + * @brief Standard system cursor shapes. + * + * These are the [standard cursor shapes](@ref cursor_standard) that can be + * requested from the platform (window system). + * + * @ingroup input + * @{ */ + +/*! @brief The regular arrow cursor shape. + * + * The regular arrow cursor shape. + */ +#define GLFW_ARROW_CURSOR 0x00036001 +/*! @brief The text input I-beam cursor shape. + * + * The text input I-beam cursor shape. + */ +#define GLFW_IBEAM_CURSOR 0x00036002 +/*! @brief The crosshair cursor shape. + * + * The crosshair cursor shape. + */ +#define GLFW_CROSSHAIR_CURSOR 0x00036003 +/*! @brief The pointing hand cursor shape. + * + * The pointing hand cursor shape. + */ +#define GLFW_POINTING_HAND_CURSOR 0x00036004 +/*! @brief The horizontal resize/move arrow shape. + * + * The horizontal resize/move arrow shape. This is usually a horizontal + * double-headed arrow. + */ +#define GLFW_RESIZE_EW_CURSOR 0x00036005 +/*! @brief The vertical resize/move arrow shape. + * + * The vertical resize/move shape. This is usually a vertical double-headed + * arrow. + */ +#define GLFW_RESIZE_NS_CURSOR 0x00036006 +/*! @brief The top-left to bottom-right diagonal resize/move arrow shape. + * + * The top-left to bottom-right diagonal resize/move shape. This is usually + * a diagonal double-headed arrow. + * + * @note @macos This shape is provided by a private system API and may fail + * with @ref GLFW_CURSOR_UNAVAILABLE in the future. + * + * @note @wayland This shape is provided by a newer standard not supported by + * all cursor themes. + * + * @note @x11 This shape is provided by a newer standard not supported by all + * cursor themes. + */ +#define GLFW_RESIZE_NWSE_CURSOR 0x00036007 +/*! @brief The top-right to bottom-left diagonal resize/move arrow shape. + * + * The top-right to bottom-left diagonal resize/move shape. This is usually + * a diagonal double-headed arrow. + * + * @note @macos This shape is provided by a private system API and may fail + * with @ref GLFW_CURSOR_UNAVAILABLE in the future. + * + * @note @wayland This shape is provided by a newer standard not supported by + * all cursor themes. + * + * @note @x11 This shape is provided by a newer standard not supported by all + * cursor themes. + */ +#define GLFW_RESIZE_NESW_CURSOR 0x00036008 +/*! @brief The omni-directional resize/move cursor shape. + * + * The omni-directional resize cursor/move shape. This is usually either + * a combined horizontal and vertical double-headed arrow or a grabbing hand. + */ +#define GLFW_RESIZE_ALL_CURSOR 0x00036009 +/*! @brief The operation-not-allowed shape. + * + * The operation-not-allowed shape. This is usually a circle with a diagonal + * line through it. + * + * @note @wayland This shape is provided by a newer standard not supported by + * all cursor themes. + * + * @note @x11 This shape is provided by a newer standard not supported by all + * cursor themes. + */ +#define GLFW_NOT_ALLOWED_CURSOR 0x0003600A +/*! @brief Legacy name for compatibility. + * + * This is an alias for compatibility with earlier versions. + */ +#define GLFW_HRESIZE_CURSOR GLFW_RESIZE_EW_CURSOR +/*! @brief Legacy name for compatibility. + * + * This is an alias for compatibility with earlier versions. + */ +#define GLFW_VRESIZE_CURSOR GLFW_RESIZE_NS_CURSOR +/*! @brief Legacy name for compatibility. + * + * This is an alias for compatibility with earlier versions. + */ +#define GLFW_HAND_CURSOR GLFW_POINTING_HAND_CURSOR +/*! @} */ + +#define GLFW_CONNECTED 0x00040001 +#define GLFW_DISCONNECTED 0x00040002 + +/*! @addtogroup init + * @{ */ +/*! @brief Joystick hat buttons init hint. + * + * Joystick hat buttons [init hint](@ref GLFW_JOYSTICK_HAT_BUTTONS). + */ +#define GLFW_JOYSTICK_HAT_BUTTONS 0x00050001 +/*! @brief ANGLE rendering backend init hint. + * + * ANGLE rendering backend [init hint](@ref GLFW_ANGLE_PLATFORM_TYPE_hint). + */ +#define GLFW_ANGLE_PLATFORM_TYPE 0x00050002 +/*! @brief Platform selection init hint. + * + * Platform selection [init hint](@ref GLFW_PLATFORM). + */ +#define GLFW_PLATFORM 0x00050003 +/*! @brief macOS specific init hint. + * + * macOS specific [init hint](@ref GLFW_COCOA_CHDIR_RESOURCES_hint). + */ +#define GLFW_COCOA_CHDIR_RESOURCES 0x00051001 +/*! @brief macOS specific init hint. + * + * macOS specific [init hint](@ref GLFW_COCOA_MENUBAR_hint). + */ +#define GLFW_COCOA_MENUBAR 0x00051002 +/*! @brief X11 specific init hint. + * + * X11 specific [init hint](@ref GLFW_X11_XCB_VULKAN_SURFACE_hint). + */ +#define GLFW_X11_XCB_VULKAN_SURFACE 0x00052001 +/*! @brief Wayland specific init hint. + * + * Wayland specific [init hint](@ref GLFW_WAYLAND_LIBDECOR_hint). + */ +#define GLFW_WAYLAND_LIBDECOR 0x00053001 +/*! @} */ + +/*! @addtogroup init + * @{ */ +/*! @brief Hint value that enables automatic platform selection. + * + * Hint value for @ref GLFW_PLATFORM that enables automatic platform selection. + */ +#define GLFW_ANY_PLATFORM 0x00060000 +#define GLFW_PLATFORM_WIN32 0x00060001 +#define GLFW_PLATFORM_COCOA 0x00060002 +#define GLFW_PLATFORM_WAYLAND 0x00060003 +#define GLFW_PLATFORM_X11 0x00060004 +#define GLFW_PLATFORM_NULL 0x00060005 +/*! @} */ + +#define GLFW_DONT_CARE -1 + + +/************************************************************************* + * GLFW API types + *************************************************************************/ + +/*! @brief Client API function pointer type. + * + * Generic function pointer used for returning client API function pointers + * without forcing a cast from a regular pointer. + * + * @sa @ref context_glext + * @sa @ref glfwGetProcAddress + * + * @since Added in version 3.0. + * + * @ingroup context + */ +typedef void (*GLFWglproc)(void); + +/*! @brief Vulkan API function pointer type. + * + * Generic function pointer used for returning Vulkan API function pointers + * without forcing a cast from a regular pointer. + * + * @sa @ref vulkan_proc + * @sa @ref glfwGetInstanceProcAddress + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +typedef void (*GLFWvkproc)(void); + +/*! @brief Opaque monitor object. + * + * Opaque monitor object. + * + * @see @ref monitor_object + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef struct GLFWmonitor GLFWmonitor; + +/*! @brief Opaque window object. + * + * Opaque window object. + * + * @see @ref window_object + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef struct GLFWwindow GLFWwindow; + +/*! @brief Opaque cursor object. + * + * Opaque cursor object. + * + * @see @ref cursor_object + * + * @since Added in version 3.1. + * + * @ingroup input + */ +typedef struct GLFWcursor GLFWcursor; + +/*! @brief The function pointer type for memory allocation callbacks. + * + * This is the function pointer type for memory allocation callbacks. A memory + * allocation callback function has the following signature: + * @code + * void* function_name(size_t size, void* user) + * @endcode + * + * This function must return either a memory block at least `size` bytes long, + * or `NULL` if allocation failed. Note that not all parts of GLFW handle allocation + * failures gracefully yet. + * + * This function must support being called during @ref glfwInit but before the library is + * flagged as initialized, as well as during @ref glfwTerminate after the library is no + * longer flagged as initialized. + * + * Any memory allocated via this function will be deallocated via the same allocator + * during library termination or earlier. + * + * Any memory allocated via this function must be suitably aligned for any object type. + * If you are using C99 or earlier, this alignment is platform-dependent but will be the + * same as what `malloc` provides. If you are using C11 or later, this is the value of + * `alignof(max_align_t)`. + * + * The size will always be greater than zero. Allocations of size zero are filtered out + * before reaching the custom allocator. + * + * If this function returns `NULL`, GLFW will emit @ref GLFW_OUT_OF_MEMORY. + * + * This function must not call any GLFW function. + * + * @param[in] size The minimum size, in bytes, of the memory block. + * @param[in] user The user-defined pointer from the allocator. + * @return The address of the newly allocated memory block, or `NULL` if an + * error occurred. + * + * @pointer_lifetime The returned memory block must be valid at least until it + * is deallocated. + * + * @reentrancy This function should not call any GLFW function. + * + * @thread_safety This function must support being called from any thread that calls GLFW + * functions. + * + * @sa @ref init_allocator + * @sa @ref GLFWallocator + * + * @since Added in version 3.4. + * + * @ingroup init + */ +typedef void* (* GLFWallocatefun)(size_t size, void* user); + +/*! @brief The function pointer type for memory reallocation callbacks. + * + * This is the function pointer type for memory reallocation callbacks. + * A memory reallocation callback function has the following signature: + * @code + * void* function_name(void* block, size_t size, void* user) + * @endcode + * + * This function must return a memory block at least `size` bytes long, or + * `NULL` if allocation failed. Note that not all parts of GLFW handle allocation + * failures gracefully yet. + * + * This function must support being called during @ref glfwInit but before the library is + * flagged as initialized, as well as during @ref glfwTerminate after the library is no + * longer flagged as initialized. + * + * Any memory allocated via this function will be deallocated via the same allocator + * during library termination or earlier. + * + * Any memory allocated via this function must be suitably aligned for any object type. + * If you are using C99 or earlier, this alignment is platform-dependent but will be the + * same as what `realloc` provides. If you are using C11 or later, this is the value of + * `alignof(max_align_t)`. + * + * The block address will never be `NULL` and the size will always be greater than zero. + * Reallocations of a block to size zero are converted into deallocations before reaching + * the custom allocator. Reallocations of `NULL` to a non-zero size are converted into + * regular allocations before reaching the custom allocator. + * + * If this function returns `NULL`, GLFW will emit @ref GLFW_OUT_OF_MEMORY. + * + * This function must not call any GLFW function. + * + * @param[in] block The address of the memory block to reallocate. + * @param[in] size The new minimum size, in bytes, of the memory block. + * @param[in] user The user-defined pointer from the allocator. + * @return The address of the newly allocated or resized memory block, or + * `NULL` if an error occurred. + * + * @pointer_lifetime The returned memory block must be valid at least until it + * is deallocated. + * + * @reentrancy This function should not call any GLFW function. + * + * @thread_safety This function must support being called from any thread that calls GLFW + * functions. + * + * @sa @ref init_allocator + * @sa @ref GLFWallocator + * + * @since Added in version 3.4. + * + * @ingroup init + */ +typedef void* (* GLFWreallocatefun)(void* block, size_t size, void* user); + +/*! @brief The function pointer type for memory deallocation callbacks. + * + * This is the function pointer type for memory deallocation callbacks. + * A memory deallocation callback function has the following signature: + * @code + * void function_name(void* block, void* user) + * @endcode + * + * This function may deallocate the specified memory block. This memory block + * will have been allocated with the same allocator. + * + * This function must support being called during @ref glfwInit but before the library is + * flagged as initialized, as well as during @ref glfwTerminate after the library is no + * longer flagged as initialized. + * + * The block address will never be `NULL`. Deallocations of `NULL` are filtered out + * before reaching the custom allocator. + * + * If this function returns `NULL`, GLFW will emit @ref GLFW_OUT_OF_MEMORY. + * + * This function must not call any GLFW function. + * + * @param[in] block The address of the memory block to deallocate. + * @param[in] user The user-defined pointer from the allocator. + * + * @pointer_lifetime The specified memory block will not be accessed by GLFW + * after this function is called. + * + * @reentrancy This function should not call any GLFW function. + * + * @thread_safety This function must support being called from any thread that calls GLFW + * functions. + * + * @sa @ref init_allocator + * @sa @ref GLFWallocator + * + * @since Added in version 3.4. + * + * @ingroup init + */ +typedef void (* GLFWdeallocatefun)(void* block, void* user); + +/*! @brief The function pointer type for error callbacks. + * + * This is the function pointer type for error callbacks. An error callback + * function has the following signature: + * @code + * void callback_name(int error_code, const char* description) + * @endcode + * + * @param[in] error_code An [error code](@ref errors). Future releases may add + * more error codes. + * @param[in] description A UTF-8 encoded string describing the error. + * + * @pointer_lifetime The error description string is valid until the callback + * function returns. + * + * @sa @ref error_handling + * @sa @ref glfwSetErrorCallback + * + * @since Added in version 3.0. + * + * @ingroup init + */ +typedef void (* GLFWerrorfun)(int error_code, const char* description); + +/*! @brief The function pointer type for window position callbacks. + * + * This is the function pointer type for window position callbacks. A window + * position callback function has the following signature: + * @code + * void callback_name(GLFWwindow* window, int xpos, int ypos) + * @endcode + * + * @param[in] window The window that was moved. + * @param[in] xpos The new x-coordinate, in screen coordinates, of the + * upper-left corner of the content area of the window. + * @param[in] ypos The new y-coordinate, in screen coordinates, of the + * upper-left corner of the content area of the window. + * + * @sa @ref window_pos + * @sa @ref glfwSetWindowPosCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowposfun)(GLFWwindow* window, int xpos, int ypos); + +/*! @brief The function pointer type for window size callbacks. + * + * This is the function pointer type for window size callbacks. A window size + * callback function has the following signature: + * @code + * void callback_name(GLFWwindow* window, int width, int height) + * @endcode + * + * @param[in] window The window that was resized. + * @param[in] width The new width, in screen coordinates, of the window. + * @param[in] height The new height, in screen coordinates, of the window. + * + * @sa @ref window_size + * @sa @ref glfwSetWindowSizeCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowsizefun)(GLFWwindow* window, int width, int height); + +/*! @brief The function pointer type for window close callbacks. + * + * This is the function pointer type for window close callbacks. A window + * close callback function has the following signature: + * @code + * void function_name(GLFWwindow* window) + * @endcode + * + * @param[in] window The window that the user attempted to close. + * + * @sa @ref window_close + * @sa @ref glfwSetWindowCloseCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowclosefun)(GLFWwindow* window); + +/*! @brief The function pointer type for window content refresh callbacks. + * + * This is the function pointer type for window content refresh callbacks. + * A window content refresh callback function has the following signature: + * @code + * void function_name(GLFWwindow* window); + * @endcode + * + * @param[in] window The window whose content needs to be refreshed. + * + * @sa @ref window_refresh + * @sa @ref glfwSetWindowRefreshCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowrefreshfun)(GLFWwindow* window); + +/*! @brief The function pointer type for window focus callbacks. + * + * This is the function pointer type for window focus callbacks. A window + * focus callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int focused) + * @endcode + * + * @param[in] window The window that gained or lost input focus. + * @param[in] focused `GLFW_TRUE` if the window was given input focus, or + * `GLFW_FALSE` if it lost it. + * + * @sa @ref window_focus + * @sa @ref glfwSetWindowFocusCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowfocusfun)(GLFWwindow* window, int focused); + +/*! @brief The function pointer type for window iconify callbacks. + * + * This is the function pointer type for window iconify callbacks. A window + * iconify callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int iconified) + * @endcode + * + * @param[in] window The window that was iconified or restored. + * @param[in] iconified `GLFW_TRUE` if the window was iconified, or + * `GLFW_FALSE` if it was restored. + * + * @sa @ref window_iconify + * @sa @ref glfwSetWindowIconifyCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowiconifyfun)(GLFWwindow* window, int iconified); + +/*! @brief The function pointer type for window maximize callbacks. + * + * This is the function pointer type for window maximize callbacks. A window + * maximize callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int maximized) + * @endcode + * + * @param[in] window The window that was maximized or restored. + * @param[in] maximized `GLFW_TRUE` if the window was maximized, or + * `GLFW_FALSE` if it was restored. + * + * @sa @ref window_maximize + * @sa glfwSetWindowMaximizeCallback + * + * @since Added in version 3.3. + * + * @ingroup window + */ +typedef void (* GLFWwindowmaximizefun)(GLFWwindow* window, int maximized); + +/*! @brief The function pointer type for framebuffer size callbacks. + * + * This is the function pointer type for framebuffer size callbacks. + * A framebuffer size callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int width, int height) + * @endcode + * + * @param[in] window The window whose framebuffer was resized. + * @param[in] width The new width, in pixels, of the framebuffer. + * @param[in] height The new height, in pixels, of the framebuffer. + * + * @sa @ref window_fbsize + * @sa @ref glfwSetFramebufferSizeCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWframebuffersizefun)(GLFWwindow* window, int width, int height); + +/*! @brief The function pointer type for window content scale callbacks. + * + * This is the function pointer type for window content scale callbacks. + * A window content scale callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, float xscale, float yscale) + * @endcode + * + * @param[in] window The window whose content scale changed. + * @param[in] xscale The new x-axis content scale of the window. + * @param[in] yscale The new y-axis content scale of the window. + * + * @sa @ref window_scale + * @sa @ref glfwSetWindowContentScaleCallback + * + * @since Added in version 3.3. + * + * @ingroup window + */ +typedef void (* GLFWwindowcontentscalefun)(GLFWwindow* window, float xscale, float yscale); + +/*! @brief The function pointer type for mouse button callbacks. + * + * This is the function pointer type for mouse button callback functions. + * A mouse button callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int button, int action, int mods) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] button The [mouse button](@ref buttons) that was pressed or + * released. + * @param[in] action One of `GLFW_PRESS` or `GLFW_RELEASE`. Future releases + * may add more actions. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_mouse_button + * @sa @ref glfwSetMouseButtonCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle and modifier mask parameters. + * + * @ingroup input + */ +typedef void (* GLFWmousebuttonfun)(GLFWwindow* window, int button, int action, int mods); + +/*! @brief The function pointer type for cursor position callbacks. + * + * This is the function pointer type for cursor position callbacks. A cursor + * position callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, double xpos, double ypos); + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] xpos The new cursor x-coordinate, relative to the left edge of + * the content area. + * @param[in] ypos The new cursor y-coordinate, relative to the top edge of the + * content area. + * + * @sa @ref cursor_pos + * @sa @ref glfwSetCursorPosCallback + * + * @since Added in version 3.0. Replaces `GLFWmouseposfun`. + * + * @ingroup input + */ +typedef void (* GLFWcursorposfun)(GLFWwindow* window, double xpos, double ypos); + +/*! @brief The function pointer type for cursor enter/leave callbacks. + * + * This is the function pointer type for cursor enter/leave callbacks. + * A cursor enter/leave callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int entered) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] entered `GLFW_TRUE` if the cursor entered the window's content + * area, or `GLFW_FALSE` if it left it. + * + * @sa @ref cursor_enter + * @sa @ref glfwSetCursorEnterCallback + * + * @since Added in version 3.0. + * + * @ingroup input + */ +typedef void (* GLFWcursorenterfun)(GLFWwindow* window, int entered); + +/*! @brief The function pointer type for scroll callbacks. + * + * This is the function pointer type for scroll callbacks. A scroll callback + * function has the following signature: + * @code + * void function_name(GLFWwindow* window, double xoffset, double yoffset) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] xoffset The scroll offset along the x-axis. + * @param[in] yoffset The scroll offset along the y-axis. + * + * @sa @ref scrolling + * @sa @ref glfwSetScrollCallback + * + * @since Added in version 3.0. Replaces `GLFWmousewheelfun`. + * + * @ingroup input + */ +typedef void (* GLFWscrollfun)(GLFWwindow* window, double xoffset, double yoffset); + +/*! @brief The function pointer type for keyboard key callbacks. + * + * This is the function pointer type for keyboard key callbacks. A keyboard + * key callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int key, int scancode, int action, int mods) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] key The [keyboard key](@ref keys) that was pressed or released. + * @param[in] scancode The platform-specific scancode of the key. + * @param[in] action `GLFW_PRESS`, `GLFW_RELEASE` or `GLFW_REPEAT`. Future + * releases may add more actions. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_key + * @sa @ref glfwSetKeyCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle, scancode and modifier mask parameters. + * + * @ingroup input + */ +typedef void (* GLFWkeyfun)(GLFWwindow* window, int key, int scancode, int action, int mods); + +/*! @brief The function pointer type for Unicode character callbacks. + * + * This is the function pointer type for Unicode character callbacks. + * A Unicode character callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, unsigned int codepoint) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] codepoint The Unicode code point of the character. + * + * @sa @ref input_char + * @sa @ref glfwSetCharCallback + * + * @since Added in version 2.4. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +typedef void (* GLFWcharfun)(GLFWwindow* window, unsigned int codepoint); + +/*! @brief The function pointer type for Unicode character with modifiers + * callbacks. + * + * This is the function pointer type for Unicode character with modifiers + * callbacks. It is called for each input character, regardless of what + * modifier keys are held down. A Unicode character with modifiers callback + * function has the following signature: + * @code + * void function_name(GLFWwindow* window, unsigned int codepoint, int mods) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] codepoint The Unicode code point of the character. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_char + * @sa @ref glfwSetCharModsCallback + * + * @deprecated Scheduled for removal in version 4.0. + * + * @since Added in version 3.1. + * + * @ingroup input + */ +typedef void (* GLFWcharmodsfun)(GLFWwindow* window, unsigned int codepoint, int mods); + +/*! @brief The function pointer type for path drop callbacks. + * + * This is the function pointer type for path drop callbacks. A path drop + * callback function has the following signature: + * @code + * void function_name(GLFWwindow* window, int path_count, const char* paths[]) + * @endcode + * + * @param[in] window The window that received the event. + * @param[in] path_count The number of dropped paths. + * @param[in] paths The UTF-8 encoded file and/or directory path names. + * + * @pointer_lifetime The path array and its strings are valid until the + * callback function returns. + * + * @sa @ref path_drop + * @sa @ref glfwSetDropCallback + * + * @since Added in version 3.1. + * + * @ingroup input + */ +typedef void (* GLFWdropfun)(GLFWwindow* window, int path_count, const char* paths[]); + +/*! @brief The function pointer type for monitor configuration callbacks. + * + * This is the function pointer type for monitor configuration callbacks. + * A monitor callback function has the following signature: + * @code + * void function_name(GLFWmonitor* monitor, int event) + * @endcode + * + * @param[in] monitor The monitor that was connected or disconnected. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. Future + * releases may add more events. + * + * @sa @ref monitor_event + * @sa @ref glfwSetMonitorCallback + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef void (* GLFWmonitorfun)(GLFWmonitor* monitor, int event); + +/*! @brief The function pointer type for joystick configuration callbacks. + * + * This is the function pointer type for joystick configuration callbacks. + * A joystick configuration callback function has the following signature: + * @code + * void function_name(int jid, int event) + * @endcode + * + * @param[in] jid The joystick that was connected or disconnected. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. Future + * releases may add more events. + * + * @sa @ref joystick_event + * @sa @ref glfwSetJoystickCallback + * + * @since Added in version 3.2. + * + * @ingroup input + */ +typedef void (* GLFWjoystickfun)(int jid, int event); + +/*! @brief Video mode type. + * + * This describes a single video mode. + * + * @sa @ref monitor_modes + * @sa @ref glfwGetVideoMode + * @sa @ref glfwGetVideoModes + * + * @since Added in version 1.0. + * @glfw3 Added refresh rate member. + * + * @ingroup monitor + */ +typedef struct GLFWvidmode +{ + /*! The width, in screen coordinates, of the video mode. + */ + int width; + /*! The height, in screen coordinates, of the video mode. + */ + int height; + /*! The bit depth of the red channel of the video mode. + */ + int redBits; + /*! The bit depth of the green channel of the video mode. + */ + int greenBits; + /*! The bit depth of the blue channel of the video mode. + */ + int blueBits; + /*! The refresh rate, in Hz, of the video mode. + */ + int refreshRate; +} GLFWvidmode; + +/*! @brief Gamma ramp. + * + * This describes the gamma ramp for a monitor. + * + * @sa @ref monitor_gamma + * @sa @ref glfwGetGammaRamp + * @sa @ref glfwSetGammaRamp + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef struct GLFWgammaramp +{ + /*! An array of value describing the response of the red channel. + */ + unsigned short* red; + /*! An array of value describing the response of the green channel. + */ + unsigned short* green; + /*! An array of value describing the response of the blue channel. + */ + unsigned short* blue; + /*! The number of elements in each array. + */ + unsigned int size; +} GLFWgammaramp; + +/*! @brief Image data. + * + * This describes a single 2D image. See the documentation for each related + * function what the expected pixel format is. + * + * @sa @ref cursor_custom + * @sa @ref window_icon + * + * @since Added in version 2.1. + * @glfw3 Removed format and bytes-per-pixel members. + * + * @ingroup window + */ +typedef struct GLFWimage +{ + /*! The width, in pixels, of this image. + */ + int width; + /*! The height, in pixels, of this image. + */ + int height; + /*! The pixel data of this image, arranged left-to-right, top-to-bottom. + */ + unsigned char* pixels; +} GLFWimage; + +/*! @brief Gamepad input state + * + * This describes the input state of a gamepad. + * + * @sa @ref gamepad + * @sa @ref glfwGetGamepadState + * + * @since Added in version 3.3. + * + * @ingroup input + */ +typedef struct GLFWgamepadstate +{ + /*! The states of each [gamepad button](@ref gamepad_buttons), `GLFW_PRESS` + * or `GLFW_RELEASE`. + */ + unsigned char buttons[15]; + /*! The states of each [gamepad axis](@ref gamepad_axes), in the range -1.0 + * to 1.0 inclusive. + */ + float axes[6]; +} GLFWgamepadstate; + +/*! @brief Custom heap memory allocator. + * + * This describes a custom heap memory allocator for GLFW. To set an allocator, pass it + * to @ref glfwInitAllocator before initializing the library. + * + * @sa @ref init_allocator + * @sa @ref glfwInitAllocator + * + * @since Added in version 3.4. + * + * @ingroup init + */ +typedef struct GLFWallocator +{ + /*! The memory allocation function. See @ref GLFWallocatefun for details about + * allocation function. + */ + GLFWallocatefun allocate; + /*! The memory reallocation function. See @ref GLFWreallocatefun for details about + * reallocation function. + */ + GLFWreallocatefun reallocate; + /*! The memory deallocation function. See @ref GLFWdeallocatefun for details about + * deallocation function. + */ + GLFWdeallocatefun deallocate; + /*! The user pointer for this custom allocator. This value will be passed to the + * allocator functions. + */ + void* user; +} GLFWallocator; + + +/************************************************************************* + * GLFW API functions + *************************************************************************/ + +/*! @brief Initializes the GLFW library. + * + * This function initializes the GLFW library. Before most GLFW functions can + * be used, GLFW must be initialized, and before an application terminates GLFW + * should be terminated in order to free any resources allocated during or + * after initialization. + * + * If this function fails, it calls @ref glfwTerminate before returning. If it + * succeeds, you should call @ref glfwTerminate before the application exits. + * + * Additional calls to this function after successful initialization but before + * termination will return `GLFW_TRUE` immediately. + * + * The @ref GLFW_PLATFORM init hint controls which platforms are considered during + * initialization. This also depends on which platforms the library was compiled to + * support. + * + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_PLATFORM_UNAVAILABLE and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @macos This function will change the current directory of the + * application to the `Contents/Resources` subdirectory of the application's + * bundle, if present. This can be disabled with the @ref + * GLFW_COCOA_CHDIR_RESOURCES init hint. + * + * @remark @macos This function will create the main menu and dock icon for the + * application. If GLFW finds a `MainMenu.nib` it is loaded and assumed to + * contain a menu bar. Otherwise a minimal menu bar is created manually with + * common commands like Hide, Quit and About. The About entry opens a minimal + * about dialog with information from the application's bundle. The menu bar + * and dock icon can be disabled entirely with the @ref GLFW_COCOA_MENUBAR init + * hint. + * + * @remark __Wayland, X11:__ If the library was compiled with support for both + * Wayland and X11, and the @ref GLFW_PLATFORM init hint is set to + * `GLFW_ANY_PLATFORM`, the `XDG_SESSION_TYPE` environment variable affects + * which platform is picked. If the environment variable is not set, or is set + * to something other than `wayland` or `x11`, the regular detection mechanism + * will be used instead. + * + * @remark @x11 This function will set the `LC_CTYPE` category of the + * application locale according to the current environment if that category is + * still "C". This is because the "C" locale breaks Unicode text input. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref intro_init + * @sa @ref glfwInitHint + * @sa @ref glfwInitAllocator + * @sa @ref glfwTerminate + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI int glfwInit(void); + +/*! @brief Terminates the GLFW library. + * + * This function destroys all remaining windows and cursors, restores any + * modified gamma ramps and frees any other allocated resources. Once this + * function is called, you must again call @ref glfwInit successfully before + * you will be able to use most GLFW functions. + * + * If GLFW has been successfully initialized, this function should be called + * before the application exits. If initialization fails, there is no need to + * call this function, as it is called by @ref glfwInit before it returns + * failure. + * + * This function has no effect if GLFW is not initialized. + * + * @errors Possible errors include @ref GLFW_PLATFORM_ERROR. + * + * @remark This function may be called before @ref glfwInit. + * + * @warning The contexts of any remaining windows must not be current on any + * other thread when this function is called. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref intro_init + * @sa @ref glfwInit + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI void glfwTerminate(void); + +/*! @brief Sets the specified init hint to the desired value. + * + * This function sets hints for the next initialization of GLFW. + * + * The values you set hints to are never reset by GLFW, but they only take + * effect during initialization. Once GLFW has been initialized, any values + * you set will be ignored until the library is terminated and initialized + * again. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [init hint](@ref init_hints) to set. + * @param[in] value The new value of the init hint. + * + * @errors Possible errors include @ref GLFW_INVALID_ENUM and @ref + * GLFW_INVALID_VALUE. + * + * @remarks This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa init_hints + * @sa glfwInit + * + * @since Added in version 3.3. + * + * @ingroup init + */ +GLFWAPI void glfwInitHint(int hint, int value); + +/*! @brief Sets the init allocator to the desired value. + * + * To use the default allocator, call this function with a `NULL` argument. + * + * If you specify an allocator struct, every member must be a valid function + * pointer. If any member is `NULL`, this function will emit @ref + * GLFW_INVALID_VALUE and the init allocator will be unchanged. + * + * The functions in the allocator must fulfil a number of requirements. See the + * documentation for @ref GLFWallocatefun, @ref GLFWreallocatefun and @ref + * GLFWdeallocatefun for details. + * + * @param[in] allocator The allocator to use at the next initialization, or + * `NULL` to use the default one. + * + * @errors Possible errors include @ref GLFW_INVALID_VALUE. + * + * @pointer_lifetime The specified allocator is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref init_allocator + * @sa @ref glfwInit + * + * @since Added in version 3.4. + * + * @ingroup init + */ +GLFWAPI void glfwInitAllocator(const GLFWallocator* allocator); + +#if defined(VK_VERSION_1_0) + +/*! @brief Sets the desired Vulkan `vkGetInstanceProcAddr` function. + * + * This function sets the `vkGetInstanceProcAddr` function that GLFW will use for all + * Vulkan related entry point queries. + * + * This feature is mostly useful on macOS, if your copy of the Vulkan loader is in + * a location where GLFW cannot find it through dynamic loading, or if you are still + * using the static library version of the loader. + * + * If set to `NULL`, GLFW will try to load the Vulkan loader dynamically by its standard + * name and get this function from there. This is the default behavior. + * + * The standard name of the loader is `vulkan-1.dll` on Windows, `libvulkan.so.1` on + * Linux and other Unix-like systems and `libvulkan.1.dylib` on macOS. If your code is + * also loading it via these names then you probably don't need to use this function. + * + * The function address you set is never reset by GLFW, but it only takes effect during + * initialization. Once GLFW has been initialized, any updates will be ignored until the + * library is terminated and initialized again. + * + * @param[in] loader The address of the function to use, or `NULL`. + * + * @par Loader function signature + * @code + * PFN_vkVoidFunction vkGetInstanceProcAddr(VkInstance instance, const char* name) + * @endcode + * For more information about this function, see the + * [Vulkan Registry](https://www.khronos.org/registry/vulkan/). + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref vulkan_loader + * @sa @ref glfwInit + * + * @since Added in version 3.4. + * + * @ingroup init + */ +GLFWAPI void glfwInitVulkanLoader(PFN_vkGetInstanceProcAddr loader); + +#endif /*VK_VERSION_1_0*/ + +/*! @brief Retrieves the version of the GLFW library. + * + * This function retrieves the major, minor and revision numbers of the GLFW + * library. It is intended for when you are using GLFW as a shared library and + * want to ensure that you are using the minimum required version. + * + * Any or all of the version arguments may be `NULL`. + * + * @param[out] major Where to store the major version number, or `NULL`. + * @param[out] minor Where to store the minor version number, or `NULL`. + * @param[out] rev Where to store the revision number, or `NULL`. + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref intro_version + * @sa @ref glfwGetVersionString + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI void glfwGetVersion(int* major, int* minor, int* rev); + +/*! @brief Returns a string describing the compile-time configuration. + * + * This function returns the compile-time generated + * [version string](@ref intro_version_string) of the GLFW library binary. It describes + * the version, platforms, compiler and any platform or operating system specific + * compile-time options. It should not be confused with the OpenGL or OpenGL ES version + * string, queried with `glGetString`. + * + * __Do not use the version string__ to parse the GLFW library version. The + * @ref glfwGetVersion function provides the version of the running library + * binary in numerical format. + * + * __Do not use the version string__ to parse what platforms are supported. The @ref + * glfwPlatformSupported function lets you query platform support. + * + * @return The ASCII encoded GLFW version string. + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @pointer_lifetime The returned string is static and compile-time generated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref intro_version + * @sa @ref glfwGetVersion + * + * @since Added in version 3.0. + * + * @ingroup init + */ +GLFWAPI const char* glfwGetVersionString(void); + +/*! @brief Returns and clears the last error for the calling thread. + * + * This function returns and clears the [error code](@ref errors) of the last + * error that occurred on the calling thread, and optionally a UTF-8 encoded + * human-readable description of it. If no error has occurred since the last + * call, it returns @ref GLFW_NO_ERROR (zero) and the description pointer is + * set to `NULL`. + * + * @param[in] description Where to store the error description pointer, or `NULL`. + * @return The last error code for the calling thread, or @ref GLFW_NO_ERROR + * (zero). + * + * @errors None. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * next error occurs or the library is terminated. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref error_handling + * @sa @ref glfwSetErrorCallback + * + * @since Added in version 3.3. + * + * @ingroup init + */ +GLFWAPI int glfwGetError(const char** description); + +/*! @brief Sets the error callback. + * + * This function sets the error callback, which is called with an error code + * and a human-readable description each time a GLFW error occurs. + * + * The error code is set before the callback is called. Calling @ref + * glfwGetError from the error callback will return the same value as the error + * code argument. + * + * The error callback is called on the thread where the error occurred. If you + * are using GLFW from multiple threads, your error callback needs to be + * written accordingly. + * + * Because the description string may have been generated specifically for that + * error, it is not guaranteed to be valid after the callback has returned. If + * you wish to use it after the callback returns, you need to make a copy. + * + * Once set, the error callback remains set even after the library has been + * terminated. + * + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set. + * + * @callback_signature + * @code + * void callback_name(int error_code, const char* description) + * @endcode + * For more information about the callback parameters, see the + * [callback pointer type](@ref GLFWerrorfun). + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref error_handling + * @sa @ref glfwGetError + * + * @since Added in version 3.0. + * + * @ingroup init + */ +GLFWAPI GLFWerrorfun glfwSetErrorCallback(GLFWerrorfun callback); + +/*! @brief Returns the currently selected platform. + * + * This function returns the platform that was selected during initialization. The + * returned value will be one of `GLFW_PLATFORM_WIN32`, `GLFW_PLATFORM_COCOA`, + * `GLFW_PLATFORM_WAYLAND`, `GLFW_PLATFORM_X11` or `GLFW_PLATFORM_NULL`. + * + * @return The currently selected platform, or zero if an error occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref platform + * @sa @ref glfwPlatformSupported + * + * @since Added in version 3.4. + * + * @ingroup init + */ +GLFWAPI int glfwGetPlatform(void); + +/*! @brief Returns whether the library includes support for the specified platform. + * + * This function returns whether the library was compiled with support for the specified + * platform. The platform must be one of `GLFW_PLATFORM_WIN32`, `GLFW_PLATFORM_COCOA`, + * `GLFW_PLATFORM_WAYLAND`, `GLFW_PLATFORM_X11` or `GLFW_PLATFORM_NULL`. + * + * @param[in] platform The platform to query. + * @return `GLFW_TRUE` if the platform is supported, or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_INVALID_ENUM. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref platform + * @sa @ref glfwGetPlatform + * + * @since Added in version 3.4. + * + * @ingroup init + */ +GLFWAPI int glfwPlatformSupported(int platform); + +/*! @brief Returns the currently connected monitors. + * + * This function returns an array of handles for all currently connected + * monitors. The primary monitor is always first in the returned array. If no + * monitors were found, this function returns `NULL`. + * + * @param[out] count Where to store the number of monitors in the returned + * array. This is set to zero if an error occurred. + * @return An array of monitor handles, or `NULL` if no monitors were found or + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * monitor configuration changes or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_monitors + * @sa @ref monitor_event + * @sa @ref glfwGetPrimaryMonitor + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitor** glfwGetMonitors(int* count); + +/*! @brief Returns the primary monitor. + * + * This function returns the primary monitor. This is usually the monitor + * where elements like the task bar or global menu bar are located. + * + * @return The primary monitor, or `NULL` if no monitors were found or if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @remark The primary monitor is always first in the array returned by @ref + * glfwGetMonitors. + * + * @sa @ref monitor_monitors + * @sa @ref glfwGetMonitors + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitor* glfwGetPrimaryMonitor(void); + +/*! @brief Returns the position of the monitor's viewport on the virtual screen. + * + * This function returns the position, in screen coordinates, of the upper-left + * corner of the specified monitor. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] xpos Where to store the monitor x-coordinate, or `NULL`. + * @param[out] ypos Where to store the monitor y-coordinate, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorPos(GLFWmonitor* monitor, int* xpos, int* ypos); + +/*! @brief Retrieves the work area of the monitor. + * + * This function returns the position, in screen coordinates, of the upper-left + * corner of the work area of the specified monitor along with the work area + * size in screen coordinates. The work area is defined as the area of the + * monitor not occluded by the window system task bar where present. If no + * task bar exists then the work area is the monitor resolution in screen + * coordinates. + * + * Any or all of the position and size arguments may be `NULL`. If an error + * occurs, all non-`NULL` position and size arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] xpos Where to store the monitor x-coordinate, or `NULL`. + * @param[out] ypos Where to store the monitor y-coordinate, or `NULL`. + * @param[out] width Where to store the monitor width, or `NULL`. + * @param[out] height Where to store the monitor height, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_workarea + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorWorkarea(GLFWmonitor* monitor, int* xpos, int* ypos, int* width, int* height); + +/*! @brief Returns the physical size of the monitor. + * + * This function returns the size, in millimetres, of the display area of the + * specified monitor. + * + * Some platforms do not provide accurate monitor size information, either + * because the monitor [EDID][] data is incorrect or because the driver does + * not report it accurately. + * + * [EDID]: https://en.wikipedia.org/wiki/Extended_display_identification_data + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] widthMM Where to store the width, in millimetres, of the + * monitor's display area, or `NULL`. + * @param[out] heightMM Where to store the height, in millimetres, of the + * monitor's display area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @win32 On Windows 8 and earlier the physical size is calculated from + * the current resolution and system DPI instead of querying the monitor EDID data. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorPhysicalSize(GLFWmonitor* monitor, int* widthMM, int* heightMM); + +/*! @brief Retrieves the content scale for the specified monitor. + * + * This function retrieves the content scale for the specified monitor. The + * content scale is the ratio between the current DPI and the platform's + * default DPI. This is especially important for text and any UI elements. If + * the pixel dimensions of your UI scaled by this look appropriate on your + * machine then it should appear at a reasonable size on other machines + * regardless of their DPI and scaling settings. This relies on the system DPI + * and scaling settings being somewhat correct. + * + * The content scale may depend on both the monitor resolution and pixel + * density and on user settings. It may be very different from the raw DPI + * calculated from the physical size and current resolution. + * + * @param[in] monitor The monitor to query. + * @param[out] xscale Where to store the x-axis content scale, or `NULL`. + * @param[out] yscale Where to store the y-axis content scale, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @wayland Fractional scaling information is not yet available for + * monitors, so this function only returns integer content scales. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_scale + * @sa @ref glfwGetWindowContentScale + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorContentScale(GLFWmonitor* monitor, float* xscale, float* yscale); + +/*! @brief Returns the name of the specified monitor. + * + * This function returns a human-readable name, encoded as UTF-8, of the + * specified monitor. The name typically reflects the make and model of the + * monitor and is not guaranteed to be unique among the connected monitors. + * + * @param[in] monitor The monitor to query. + * @return The UTF-8 encoded name of the monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI const char* glfwGetMonitorName(GLFWmonitor* monitor); + +/*! @brief Sets the user pointer of the specified monitor. + * + * This function sets the user-defined pointer of the specified monitor. The + * current value is retained until the monitor is disconnected. The initial + * value is `NULL`. + * + * This function may be called from the monitor callback, even for a monitor + * that is being disconnected. + * + * @param[in] monitor The monitor whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref monitor_userptr + * @sa @ref glfwGetMonitorUserPointer + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetMonitorUserPointer(GLFWmonitor* monitor, void* pointer); + +/*! @brief Returns the user pointer of the specified monitor. + * + * This function returns the current value of the user-defined pointer of the + * specified monitor. The initial value is `NULL`. + * + * This function may be called from the monitor callback, even for a monitor + * that is being disconnected. + * + * @param[in] monitor The monitor whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref monitor_userptr + * @sa @ref glfwSetMonitorUserPointer + * + * @since Added in version 3.3. + * + * @ingroup monitor + */ +GLFWAPI void* glfwGetMonitorUserPointer(GLFWmonitor* monitor); + +/*! @brief Sets the monitor configuration callback. + * + * This function sets the monitor configuration callback, or removes the + * currently set callback. This is called when a monitor is connected to or + * disconnected from the system. + * + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWmonitor* monitor, int event) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWmonitorfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_event + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitorfun glfwSetMonitorCallback(GLFWmonitorfun callback); + +/*! @brief Returns the available video modes for the specified monitor. + * + * This function returns an array of all video modes supported by the specified + * monitor. The returned array is sorted in ascending order, first by color + * bit depth (the sum of all channel depths), then by resolution area (the + * product of width and height), then resolution width and finally by refresh + * rate. + * + * @param[in] monitor The monitor to query. + * @param[out] count Where to store the number of video modes in the returned + * array. This is set to zero if an error occurred. + * @return An array of video modes, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected, this function is called again for that monitor or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_modes + * @sa @ref glfwGetVideoMode + * + * @since Added in version 1.0. + * @glfw3 Changed to return an array of modes for a specific monitor. + * + * @ingroup monitor + */ +GLFWAPI const GLFWvidmode* glfwGetVideoModes(GLFWmonitor* monitor, int* count); + +/*! @brief Returns the current mode of the specified monitor. + * + * This function returns the current video mode of the specified monitor. If + * you have created a full screen window for that monitor, the return value + * will depend on whether that window is iconified. + * + * @param[in] monitor The monitor to query. + * @return The current mode of the monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_modes + * @sa @ref glfwGetVideoModes + * + * @since Added in version 3.0. Replaces `glfwGetDesktopMode`. + * + * @ingroup monitor + */ +GLFWAPI const GLFWvidmode* glfwGetVideoMode(GLFWmonitor* monitor); + +/*! @brief Generates a gamma ramp and sets it for the specified monitor. + * + * This function generates an appropriately sized gamma ramp from the specified + * exponent and then calls @ref glfwSetGammaRamp with it. The value must be + * a finite number greater than zero. + * + * The software controlled gamma ramp is applied _in addition_ to the hardware + * gamma correction, which today is usually an approximation of sRGB gamma. + * This means that setting a perfectly linear ramp, or gamma 1.0, will produce + * the default (usually sRGB-like) behavior. + * + * For gamma correct rendering with OpenGL or OpenGL ES, see the @ref + * GLFW_SRGB_CAPABLE hint. + * + * @param[in] monitor The monitor whose gamma ramp to set. + * @param[in] gamma The desired exponent. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref GLFW_INVALID_VALUE, + * @ref GLFW_PLATFORM_ERROR and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland Gamma handling is a privileged protocol, this function + * will thus never be implemented and emits @ref GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetGamma(GLFWmonitor* monitor, float gamma); + +/*! @brief Returns the current gamma ramp for the specified monitor. + * + * This function returns the current gamma ramp of the specified monitor. + * + * @param[in] monitor The monitor to query. + * @return The current gamma ramp, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref GLFW_PLATFORM_ERROR + * and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland Gamma handling is a privileged protocol, this function + * will thus never be implemented and emits @ref GLFW_FEATURE_UNAVAILABLE while + * returning `NULL`. + * + * @pointer_lifetime The returned structure and its arrays are allocated and + * freed by GLFW. You should not free them yourself. They are valid until the + * specified monitor is disconnected, this function is called again for that + * monitor or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI const GLFWgammaramp* glfwGetGammaRamp(GLFWmonitor* monitor); + +/*! @brief Sets the current gamma ramp for the specified monitor. + * + * This function sets the current gamma ramp for the specified monitor. The + * original gamma ramp for that monitor is saved by GLFW the first time this + * function is called and is restored by @ref glfwTerminate. + * + * The software controlled gamma ramp is applied _in addition_ to the hardware + * gamma correction, which today is usually an approximation of sRGB gamma. + * This means that setting a perfectly linear ramp, or gamma 1.0, will produce + * the default (usually sRGB-like) behavior. + * + * For gamma correct rendering with OpenGL or OpenGL ES, see the @ref + * GLFW_SRGB_CAPABLE hint. + * + * @param[in] monitor The monitor whose gamma ramp to set. + * @param[in] ramp The gamma ramp to use. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref GLFW_PLATFORM_ERROR + * and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark The size of the specified gamma ramp should match the size of the + * current ramp for that monitor. + * + * @remark @win32 The gamma ramp size must be 256. + * + * @remark @wayland Gamma handling is a privileged protocol, this function + * will thus never be implemented and emits @ref GLFW_FEATURE_UNAVAILABLE. + * + * @pointer_lifetime The specified gamma ramp is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetGammaRamp(GLFWmonitor* monitor, const GLFWgammaramp* ramp); + +/*! @brief Resets all window hints to their default values. + * + * This function resets all window hints to their + * [default values](@ref window_hints_values). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa @ref glfwWindowHint + * @sa @ref glfwWindowHintString + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwDefaultWindowHints(void); + +/*! @brief Sets the specified window hint to the desired value. + * + * This function sets hints for the next call to @ref glfwCreateWindow. The + * hints, once set, retain their values until changed by a call to this + * function or @ref glfwDefaultWindowHints, or until the library is terminated. + * + * Only integer value hints can be set with this function. String value hints + * are set with @ref glfwWindowHintString. + * + * This function does not check whether the specified hint values are valid. + * If you set hints to invalid values this will instead be reported by the next + * call to @ref glfwCreateWindow. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [window hint](@ref window_hints) to set. + * @param[in] value The new value of the window hint. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa @ref glfwWindowHintString + * @sa @ref glfwDefaultWindowHints + * + * @since Added in version 3.0. Replaces `glfwOpenWindowHint`. + * + * @ingroup window + */ +GLFWAPI void glfwWindowHint(int hint, int value); + +/*! @brief Sets the specified window hint to the desired value. + * + * This function sets hints for the next call to @ref glfwCreateWindow. The + * hints, once set, retain their values until changed by a call to this + * function or @ref glfwDefaultWindowHints, or until the library is terminated. + * + * Only string type hints can be set with this function. Integer value hints + * are set with @ref glfwWindowHint. + * + * This function does not check whether the specified hint values are valid. + * If you set hints to invalid values this will instead be reported by the next + * call to @ref glfwCreateWindow. + * + * Some hints are platform specific. These may be set on any platform but they + * will only affect their specific platform. Other platforms will ignore them. + * Setting these hints requires no platform specific headers or functions. + * + * @param[in] hint The [window hint](@ref window_hints) to set. + * @param[in] value The new value of the window hint. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa @ref glfwWindowHint + * @sa @ref glfwDefaultWindowHints + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwWindowHintString(int hint, const char* value); + +/*! @brief Creates a window and its associated context. + * + * This function creates a window and its associated OpenGL or OpenGL ES + * context. Most of the options controlling how the window and its context + * should be created are specified with [window hints](@ref window_hints). + * + * Successful creation does not change which context is current. Before you + * can use the newly created context, you need to + * [make it current](@ref context_current). For information about the `share` + * parameter, see @ref context_sharing. + * + * The created window, framebuffer and context may differ from what you + * requested, as not all parameters and hints are + * [hard constraints](@ref window_hints_hard). This includes the size of the + * window, especially for full screen windows. To query the actual attributes + * of the created window, framebuffer and context, see @ref + * glfwGetWindowAttrib, @ref glfwGetWindowSize and @ref glfwGetFramebufferSize. + * + * To create a full screen window, you need to specify the monitor the window + * will cover. If no monitor is specified, the window will be windowed mode. + * Unless you have a way for the user to choose a specific monitor, it is + * recommended that you pick the primary monitor. For more information on how + * to query connected monitors, see @ref monitor_monitors. + * + * For full screen windows, the specified size becomes the resolution of the + * window's _desired video mode_. As long as a full screen window is not + * iconified, the supported video mode most closely matching the desired video + * mode is set for the specified monitor. For more information about full + * screen windows, including the creation of so called _windowed full screen_ + * or _borderless full screen_ windows, see @ref window_windowed_full_screen. + * + * Once you have created the window, you can switch it between windowed and + * full screen mode with @ref glfwSetWindowMonitor. This will not affect its + * OpenGL or OpenGL ES context. + * + * By default, newly created windows use the placement recommended by the + * window system. To create the window at a specific position, set the @ref + * GLFW_POSITION_X and @ref GLFW_POSITION_Y window hints before creation. To + * restore the default behavior, set either or both hints back to + * `GLFW_ANY_POSITION`. + * + * As long as at least one full screen window is not iconified, the screensaver + * is prohibited from starting. + * + * Window systems put limits on window sizes. Very large or very small window + * dimensions may be overridden by the window system on creation. Check the + * actual [size](@ref window_size) after creation. + * + * The [swap interval](@ref buffer_swap) is not set during window creation and + * the initial value may vary depending on driver settings and defaults. + * + * @param[in] width The desired width, in screen coordinates, of the window. + * This must be greater than zero. + * @param[in] height The desired height, in screen coordinates, of the window. + * This must be greater than zero. + * @param[in] title The initial, UTF-8 encoded window title. + * @param[in] monitor The monitor to use for full screen mode, or `NULL` for + * windowed mode. + * @param[in] share The window whose context to share resources with, or `NULL` + * to not share resources. + * @return The handle of the created window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_INVALID_VALUE, @ref GLFW_API_UNAVAILABLE, @ref + * GLFW_VERSION_UNAVAILABLE, @ref GLFW_FORMAT_UNAVAILABLE, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark @win32 Window creation will fail if the Microsoft GDI software + * OpenGL implementation is the only one available. + * + * @remark @win32 If the executable has an icon resource named `GLFW_ICON,` it + * will be set as the initial icon for the window. If no such icon is present, + * the `IDI_APPLICATION` icon will be used instead. To set a different icon, + * see @ref glfwSetWindowIcon. + * + * @remark @win32 The context to share resources with must not be current on + * any other thread. + * + * @remark @macos The OS only supports core profile contexts for OpenGL + * versions 3.2 and later. Before creating an OpenGL context of version 3.2 or + * later you must set the [GLFW_OPENGL_PROFILE](@ref GLFW_OPENGL_PROFILE_hint) + * hint accordingly. OpenGL 3.0 and 3.1 contexts are not supported at all + * on macOS. + * + * @remark @macos The GLFW window has no icon, as it is not a document + * window, but the dock icon will be the same as the application bundle's icon. + * For more information on bundles, see the + * [Bundle Programming Guide][bundle-guide] in the Mac Developer Library. + * + * [bundle-guide]: https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/ + * + * @remark @macos On OS X 10.10 and later the window frame will not be rendered + * at full resolution on Retina displays unless the + * [GLFW_SCALE_FRAMEBUFFER](@ref GLFW_SCALE_FRAMEBUFFER_hint) + * hint is `GLFW_TRUE` and the `NSHighResolutionCapable` key is enabled in the + * application bundle's `Info.plist`. For more information, see + * [High Resolution Guidelines for OS X][hidpi-guide] in the Mac Developer + * Library. The GLFW test and example programs use a custom `Info.plist` + * template for this, which can be found as `CMake/Info.plist.in` in the source + * tree. + * + * [hidpi-guide]: https://developer.apple.com/library/mac/documentation/GraphicsAnimation/Conceptual/HighResolutionOSX/Explained/Explained.html + * + * @remark @macos When activating frame autosaving with + * [GLFW_COCOA_FRAME_NAME](@ref GLFW_COCOA_FRAME_NAME_hint), the specified + * window size and position may be overridden by previously saved values. + * + * @remark @wayland GLFW uses [libdecor][] where available to create its window + * decorations. This in turn uses server-side XDG decorations where available + * and provides high quality client-side decorations on compositors like GNOME. + * If both XDG decorations and libdecor are unavailable, GLFW falls back to + * a very simple set of window decorations that only support moving, resizing + * and the window manager's right-click menu. + * + * [libdecor]: https://gitlab.freedesktop.org/libdecor/libdecor + * + * @remark @x11 Some window managers will not respect the placement of + * initially hidden windows. + * + * @remark @x11 Due to the asynchronous nature of X11, it may take a moment for + * a window to reach its requested state. This means you may not be able to + * query the final size, position or other attributes directly after window + * creation. + * + * @remark @x11 The class part of the `WM_CLASS` window property will by + * default be set to the window title passed to this function. The instance + * part will use the contents of the `RESOURCE_NAME` environment variable, if + * present and not empty, or fall back to the window title. Set the + * [GLFW_X11_CLASS_NAME](@ref GLFW_X11_CLASS_NAME_hint) and + * [GLFW_X11_INSTANCE_NAME](@ref GLFW_X11_INSTANCE_NAME_hint) window hints to + * override this. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_creation + * @sa @ref glfwDestroyWindow + * + * @since Added in version 3.0. Replaces `glfwOpenWindow`. + * + * @ingroup window + */ +GLFWAPI GLFWwindow* glfwCreateWindow(int width, int height, const char* title, GLFWmonitor* monitor, GLFWwindow* share); + +/*! @brief Destroys the specified window and its context. + * + * This function destroys the specified window and its context. On calling + * this function, no further callbacks will be called for that window. + * + * If the context of the specified window is current on the main thread, it is + * detached before being destroyed. + * + * @param[in] window The window to destroy. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @note The context of the specified window must not be current on any other + * thread when this function is called. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_creation + * @sa @ref glfwCreateWindow + * + * @since Added in version 3.0. Replaces `glfwCloseWindow`. + * + * @ingroup window + */ +GLFWAPI void glfwDestroyWindow(GLFWwindow* window); + +/*! @brief Checks the close flag of the specified window. + * + * This function returns the value of the close flag of the specified window. + * + * @param[in] window The window to query. + * @return The value of the close flag. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_close + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI int glfwWindowShouldClose(GLFWwindow* window); + +/*! @brief Sets the close flag of the specified window. + * + * This function sets the value of the close flag of the specified window. + * This can be used to override the user's attempt to close the window, or + * to signal that it should be closed. + * + * @param[in] window The window whose flag to change. + * @param[in] value The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_close + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowShouldClose(GLFWwindow* window, int value); + +/*! @brief Returns the title of the specified window. + * + * This function returns the window title, encoded as UTF-8, of the specified + * window. This is the title set previously by @ref glfwCreateWindow + * or @ref glfwSetWindowTitle. + * + * @param[in] window The window to query. + * @return The UTF-8 encoded window title, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark The returned title is currently a copy of the title last set by @ref + * glfwCreateWindow or @ref glfwSetWindowTitle. It does not include any + * additional text which may be appended by the platform or another program. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetWindowTitle or @ref glfwSetWindowTitle, or until the library is + * terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_title + * @sa @ref glfwSetWindowTitle + * + * @since Added in version 3.4. + * + * @ingroup window + */ +GLFWAPI const char* glfwGetWindowTitle(GLFWwindow* window); + +/*! @brief Sets the title of the specified window. + * + * This function sets the window title, encoded as UTF-8, of the specified + * window. + * + * @param[in] window The window whose title to change. + * @param[in] title The UTF-8 encoded window title. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @macos The window title will not be updated until the next time you + * process events. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_title + * @sa @ref glfwGetWindowTitle + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowTitle(GLFWwindow* window, const char* title); + +/*! @brief Sets the icon for the specified window. + * + * This function sets the icon of the specified window. If passed an array of + * candidate images, those of or closest to the sizes desired by the system are + * selected. If no images are specified, the window reverts to its default + * icon. + * + * The pixels are 32-bit, little-endian, non-premultiplied RGBA, i.e. eight + * bits per channel with the red channel first. They are arranged canonically + * as packed sequential rows, starting from the top-left corner. + * + * The desired image sizes varies depending on platform and system settings. + * The selected images will be rescaled as needed. Good sizes include 16x16, + * 32x32 and 48x48. + * + * @param[in] window The window whose icon to set. + * @param[in] count The number of images in the specified array, or zero to + * revert to the default window icon. + * @param[in] images The images to create the icon from. This is ignored if + * count is zero. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE, @ref GLFW_PLATFORM_ERROR and @ref + * GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @pointer_lifetime The specified image data is copied before this function + * returns. + * + * @remark @macos Regular windows do not have icons on macOS. This function + * will emit @ref GLFW_FEATURE_UNAVAILABLE. The dock icon will be the same as + * the application bundle's icon. For more information on bundles, see the + * [Bundle Programming Guide][bundle-guide] in the Mac Developer Library. + * + * [bundle-guide]: https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/ + * + * @remark @wayland There is no existing protocol to change an icon, the + * window will thus inherit the one defined in the application's desktop file. + * This function will emit @ref GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_icon + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowIcon(GLFWwindow* window, int count, const GLFWimage* images); + +/*! @brief Retrieves the position of the content area of the specified window. + * + * This function retrieves the position, in screen coordinates, of the + * upper-left corner of the content area of the specified window. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] window The window to query. + * @param[out] xpos Where to store the x-coordinate of the upper-left corner of + * the content area, or `NULL`. + * @param[out] ypos Where to store the y-coordinate of the upper-left corner of + * the content area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_ERROR and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland There is no way for an application to retrieve the global + * position of its windows. This function will emit @ref + * GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * @sa @ref glfwSetWindowPos + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowPos(GLFWwindow* window, int* xpos, int* ypos); + +/*! @brief Sets the position of the content area of the specified window. + * + * This function sets the position, in screen coordinates, of the upper-left + * corner of the content area of the specified windowed mode window. If the + * window is a full screen window, this function does nothing. + * + * __Do not use this function__ to move an already visible window unless you + * have very good reasons for doing so, as it will confuse and annoy the user. + * + * The window manager may put limits on what positions are allowed. GLFW + * cannot and should not override these limits. + * + * @param[in] window The window to query. + * @param[in] xpos The x-coordinate of the upper-left corner of the content area. + * @param[in] ypos The y-coordinate of the upper-left corner of the content area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_ERROR and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland There is no way for an application to set the global + * position of its windows. This function will emit @ref + * GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * @sa @ref glfwGetWindowPos + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowPos(GLFWwindow* window, int xpos, int ypos); + +/*! @brief Retrieves the size of the content area of the specified window. + * + * This function retrieves the size, in screen coordinates, of the content area + * of the specified window. If you wish to retrieve the size of the + * framebuffer of the window in pixels, see @ref glfwGetFramebufferSize. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose size to retrieve. + * @param[out] width Where to store the width, in screen coordinates, of the + * content area, or `NULL`. + * @param[out] height Where to store the height, in screen coordinates, of the + * content area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * @sa @ref glfwSetWindowSize + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowSize(GLFWwindow* window, int* width, int* height); + +/*! @brief Sets the size limits of the specified window. + * + * This function sets the size limits of the content area of the specified + * window. If the window is full screen, the size limits only take effect + * once it is made windowed. If the window is not resizable, this function + * does nothing. + * + * The size limits are applied immediately to a windowed mode window and may + * cause it to be resized. + * + * The maximum dimensions must be greater than or equal to the minimum + * dimensions and all must be greater than or equal to zero. + * + * @param[in] window The window to set limits for. + * @param[in] minwidth The minimum width, in screen coordinates, of the content + * area, or `GLFW_DONT_CARE`. + * @param[in] minheight The minimum height, in screen coordinates, of the + * content area, or `GLFW_DONT_CARE`. + * @param[in] maxwidth The maximum width, in screen coordinates, of the content + * area, or `GLFW_DONT_CARE`. + * @param[in] maxheight The maximum height, in screen coordinates, of the + * content area, or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @remark @wayland The size limits will not be applied until the window is + * actually resized, either by the user or by the compositor. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa @ref glfwSetWindowAspectRatio + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowSizeLimits(GLFWwindow* window, int minwidth, int minheight, int maxwidth, int maxheight); + +/*! @brief Sets the aspect ratio of the specified window. + * + * This function sets the required aspect ratio of the content area of the + * specified window. If the window is full screen, the aspect ratio only takes + * effect once it is made windowed. If the window is not resizable, this + * function does nothing. + * + * The aspect ratio is specified as a numerator and a denominator and both + * values must be greater than zero. For example, the common 16:9 aspect ratio + * is specified as 16 and 9, respectively. + * + * If the numerator and denominator is set to `GLFW_DONT_CARE` then the aspect + * ratio limit is disabled. + * + * The aspect ratio is applied immediately to a windowed mode window and may + * cause it to be resized. + * + * @param[in] window The window to set limits for. + * @param[in] numer The numerator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * @param[in] denom The denominator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @remark @wayland The aspect ratio will not be applied until the window is + * actually resized, either by the user or by the compositor. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa @ref glfwSetWindowSizeLimits + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowAspectRatio(GLFWwindow* window, int numer, int denom); + +/*! @brief Sets the size of the content area of the specified window. + * + * This function sets the size, in screen coordinates, of the content area of + * the specified window. + * + * For full screen windows, this function updates the resolution of its desired + * video mode and switches to the video mode closest to it, without affecting + * the window's context. As the context is unaffected, the bit depths of the + * framebuffer remain unchanged. + * + * If you wish to update the refresh rate of the desired video mode in addition + * to its resolution, see @ref glfwSetWindowMonitor. + * + * The window manager may put limits on what sizes are allowed. GLFW cannot + * and should not override these limits. + * + * @param[in] window The window to resize. + * @param[in] width The desired width, in screen coordinates, of the window + * content area. + * @param[in] height The desired height, in screen coordinates, of the window + * content area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * @sa @ref glfwGetWindowSize + * @sa @ref glfwSetWindowMonitor + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowSize(GLFWwindow* window, int width, int height); + +/*! @brief Retrieves the size of the framebuffer of the specified window. + * + * This function retrieves the size, in pixels, of the framebuffer of the + * specified window. If you wish to retrieve the size of the window in screen + * coordinates, see @ref glfwGetWindowSize. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose framebuffer to query. + * @param[out] width Where to store the width, in pixels, of the framebuffer, + * or `NULL`. + * @param[out] height Where to store the height, in pixels, of the framebuffer, + * or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_fbsize + * @sa @ref glfwSetFramebufferSizeCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwGetFramebufferSize(GLFWwindow* window, int* width, int* height); + +/*! @brief Retrieves the size of the frame of the window. + * + * This function retrieves the size, in screen coordinates, of each edge of the + * frame of the specified window. This size includes the title bar, if the + * window has one. The size of the frame may vary depending on the + * [window-related hints](@ref window_hints_wnd) used to create it. + * + * Because this function retrieves the size of each window frame edge and not + * the offset along a particular coordinate axis, the retrieved values will + * always be zero or positive. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose frame size to query. + * @param[out] left Where to store the size, in screen coordinates, of the left + * edge of the window frame, or `NULL`. + * @param[out] top Where to store the size, in screen coordinates, of the top + * edge of the window frame, or `NULL`. + * @param[out] right Where to store the size, in screen coordinates, of the + * right edge of the window frame, or `NULL`. + * @param[out] bottom Where to store the size, in screen coordinates, of the + * bottom edge of the window frame, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * + * @since Added in version 3.1. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowFrameSize(GLFWwindow* window, int* left, int* top, int* right, int* bottom); + +/*! @brief Retrieves the content scale for the specified window. + * + * This function retrieves the content scale for the specified window. The + * content scale is the ratio between the current DPI and the platform's + * default DPI. This is especially important for text and any UI elements. If + * the pixel dimensions of your UI scaled by this look appropriate on your + * machine then it should appear at a reasonable size on other machines + * regardless of their DPI and scaling settings. This relies on the system DPI + * and scaling settings being somewhat correct. + * + * On platforms where each monitors can have its own content scale, the window + * content scale will depend on which monitor the system considers the window + * to be on. + * + * @param[in] window The window to query. + * @param[out] xscale Where to store the x-axis content scale, or `NULL`. + * @param[out] yscale Where to store the y-axis content scale, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_scale + * @sa @ref glfwSetWindowContentScaleCallback + * @sa @ref glfwGetMonitorContentScale + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowContentScale(GLFWwindow* window, float* xscale, float* yscale); + +/*! @brief Returns the opacity of the whole window. + * + * This function returns the opacity of the window, including any decorations. + * + * The opacity (or alpha) value is a positive finite number between zero and + * one, where zero is fully transparent and one is fully opaque. If the system + * does not support whole window transparency, this function always returns one. + * + * The initial opacity value for newly created windows is one. + * + * @param[in] window The window to query. + * @return The opacity value of the specified window. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_transparency + * @sa @ref glfwSetWindowOpacity + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI float glfwGetWindowOpacity(GLFWwindow* window); + +/*! @brief Sets the opacity of the whole window. + * + * This function sets the opacity of the window, including any decorations. + * + * The opacity (or alpha) value is a positive finite number between zero and + * one, where zero is fully transparent and one is fully opaque. + * + * The initial opacity value for newly created windows is one. + * + * A window created with framebuffer transparency may not use whole window + * transparency. The results of doing this are undefined. + * + * @param[in] window The window to set the opacity for. + * @param[in] opacity The desired opacity of the specified window. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_ERROR and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland There is no way to set an opacity factor for a window. + * This function will emit @ref GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_transparency + * @sa @ref glfwGetWindowOpacity + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowOpacity(GLFWwindow* window, float opacity); + +/*! @brief Iconifies the specified window. + * + * This function iconifies (minimizes) the specified window if it was + * previously restored. If the window is already iconified, this function does + * nothing. + * + * If the specified window is a full screen window, GLFW restores the original + * video mode of the monitor. The window's desired video mode is set again + * when the window is restored. + * + * @param[in] window The window to iconify. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @wayland Once a window is iconified, @ref glfwRestoreWindow won’t + * be able to restore it. This is a design decision of the xdg-shell + * protocol. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * @sa @ref glfwRestoreWindow + * @sa @ref glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwIconifyWindow(GLFWwindow* window); + +/*! @brief Restores the specified window. + * + * This function restores the specified window if it was previously iconified + * (minimized) or maximized. If the window is already restored, this function + * does nothing. + * + * If the specified window is an iconified full screen window, its desired + * video mode is set again for its monitor when the window is restored. + * + * @param[in] window The window to restore. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * @sa @ref glfwIconifyWindow + * @sa @ref glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwRestoreWindow(GLFWwindow* window); + +/*! @brief Maximizes the specified window. + * + * This function maximizes the specified window if it was previously not + * maximized. If the window is already maximized, this function does nothing. + * + * If the specified window is a full screen window, this function does nothing. + * + * @param[in] window The window to maximize. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @par Thread Safety + * This function may only be called from the main thread. + * + * @sa @ref window_iconify + * @sa @ref glfwIconifyWindow + * @sa @ref glfwRestoreWindow + * + * @since Added in GLFW 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwMaximizeWindow(GLFWwindow* window); + +/*! @brief Makes the specified window visible. + * + * This function makes the specified window visible if it was previously + * hidden. If the window is already visible or is in full screen mode, this + * function does nothing. + * + * By default, windowed mode windows are focused when shown + * Set the [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_hint) window hint + * to change this behavior for all newly created windows, or change the + * behavior for an existing window with @ref glfwSetWindowAttrib. + * + * @param[in] window The window to make visible. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @wayland Because Wayland wants every frame of the desktop to be + * complete, this function does not immediately make the window visible. + * Instead it will become visible the next time the window framebuffer is + * updated after this call. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hide + * @sa @ref glfwHideWindow + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwShowWindow(GLFWwindow* window); + +/*! @brief Hides the specified window. + * + * This function hides the specified window if it was previously visible. If + * the window is already hidden or is in full screen mode, this function does + * nothing. + * + * @param[in] window The window to hide. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hide + * @sa @ref glfwShowWindow + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwHideWindow(GLFWwindow* window); + +/*! @brief Brings the specified window to front and sets input focus. + * + * This function brings the specified window to front and sets input focus. + * The window should already be visible and not iconified. + * + * By default, both windowed and full screen mode windows are focused when + * initially created. Set the [GLFW_FOCUSED](@ref GLFW_FOCUSED_hint) to + * disable this behavior. + * + * Also by default, windowed mode windows are focused when shown + * with @ref glfwShowWindow. Set the + * [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_hint) to disable this behavior. + * + * __Do not use this function__ to steal focus from other applications unless + * you are certain that is what the user wants. Focus stealing can be + * extremely disruptive. + * + * For a less disruptive way of getting the user's attention, see + * [attention requests](@ref window_attention). + * + * @param[in] window The window to give input focus. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @wayland The compositor will likely ignore focus requests unless + * another window created by the same application already has input focus. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_focus + * @sa @ref window_attention + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwFocusWindow(GLFWwindow* window); + +/*! @brief Requests user attention to the specified window. + * + * This function requests user attention to the specified window. On + * platforms where this is not supported, attention is requested to the + * application as a whole. + * + * Once the user has given attention, usually by focusing the window or + * application, the system will end the request automatically. + * + * @param[in] window The window to request attention to. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @macos Attention is requested to the application as a whole, not the + * specific window. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attention + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwRequestWindowAttention(GLFWwindow* window); + +/*! @brief Returns the monitor that the window uses for full screen mode. + * + * This function returns the handle of the monitor that the specified window is + * in full screen on. + * + * @param[in] window The window to query. + * @return The monitor, or `NULL` if the window is in windowed mode or an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_monitor + * @sa @ref glfwSetWindowMonitor + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWmonitor* glfwGetWindowMonitor(GLFWwindow* window); + +/*! @brief Sets the mode, monitor, video mode and placement of a window. + * + * This function sets the monitor that the window uses for full screen mode or, + * if the monitor is `NULL`, makes it windowed mode. + * + * When setting a monitor, this function updates the width, height and refresh + * rate of the desired video mode and switches to the video mode closest to it. + * The window position is ignored when setting a monitor. + * + * When the monitor is `NULL`, the position, width and height are used to + * place the window content area. The refresh rate is ignored when no monitor + * is specified. + * + * If you only wish to update the resolution of a full screen window or the + * size of a windowed mode window, see @ref glfwSetWindowSize. + * + * When a window transitions from full screen to windowed mode, this function + * restores any previous window settings such as whether it is decorated, + * floating, resizable, has size or aspect ratio limits, etc. + * + * @param[in] window The window whose monitor, size or video mode to set. + * @param[in] monitor The desired monitor, or `NULL` to set windowed mode. + * @param[in] xpos The desired x-coordinate of the upper-left corner of the + * content area. + * @param[in] ypos The desired y-coordinate of the upper-left corner of the + * content area. + * @param[in] width The desired with, in screen coordinates, of the content + * area or video mode. + * @param[in] height The desired height, in screen coordinates, of the content + * area or video mode. + * @param[in] refreshRate The desired refresh rate, in Hz, of the video mode, + * or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark The OpenGL or OpenGL ES context will not be destroyed or otherwise + * affected by any resizing or mode switching, although you may need to update + * your viewport if the framebuffer size has changed. + * + * @remark @wayland The desired window position is ignored, as there is no way + * for an application to set this property. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_monitor + * @sa @ref window_full_screen + * @sa @ref glfwGetWindowMonitor + * @sa @ref glfwSetWindowSize + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowMonitor(GLFWwindow* window, GLFWmonitor* monitor, int xpos, int ypos, int width, int height, int refreshRate); + +/*! @brief Returns an attribute of the specified window. + * + * This function returns the value of an attribute of the specified window or + * its OpenGL or OpenGL ES context. + * + * @param[in] window The window to query. + * @param[in] attrib The [window attribute](@ref window_attribs) whose value to + * return. + * @return The value of the attribute, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @remark Framebuffer related hints are not window attributes. See @ref + * window_attribs_fb for more information. + * + * @remark Zero is a valid value for many window and context related + * attributes so you cannot use a return value of zero as an indication of + * errors. However, this function should not fail as long as it is passed + * valid arguments and the library has been [initialized](@ref intro_init). + * + * @remark @wayland The Wayland protocol provides no way to check whether a + * window is iconfied, so @ref GLFW_ICONIFIED always returns `GLFW_FALSE`. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attribs + * @sa @ref glfwSetWindowAttrib + * + * @since Added in version 3.0. Replaces `glfwGetWindowParam` and + * `glfwGetGLVersion`. + * + * @ingroup window + */ +GLFWAPI int glfwGetWindowAttrib(GLFWwindow* window, int attrib); + +/*! @brief Sets an attribute of the specified window. + * + * This function sets the value of an attribute of the specified window. + * + * The supported attributes are [GLFW_DECORATED](@ref GLFW_DECORATED_attrib), + * [GLFW_RESIZABLE](@ref GLFW_RESIZABLE_attrib), + * [GLFW_FLOATING](@ref GLFW_FLOATING_attrib), + * [GLFW_AUTO_ICONIFY](@ref GLFW_AUTO_ICONIFY_attrib) and + * [GLFW_FOCUS_ON_SHOW](@ref GLFW_FOCUS_ON_SHOW_attrib). + * [GLFW_MOUSE_PASSTHROUGH](@ref GLFW_MOUSE_PASSTHROUGH_attrib) + * + * Some of these attributes are ignored for full screen windows. The new + * value will take effect if the window is later made windowed. + * + * Some of these attributes are ignored for windowed mode windows. The new + * value will take effect if the window is later made full screen. + * + * @param[in] window The window to set the attribute for. + * @param[in] attrib A supported window attribute. + * @param[in] value `GLFW_TRUE` or `GLFW_FALSE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_INVALID_VALUE, @ref GLFW_PLATFORM_ERROR and @ref + * GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark Calling @ref glfwGetWindowAttrib will always return the latest + * value, even if that value is ignored by the current mode of the window. + * + * @remark @wayland The [GLFW_FLOATING](@ref GLFW_FLOATING_attrib) window attribute is + * not supported. Setting this will emit @ref GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attribs + * @sa @ref glfwGetWindowAttrib + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowAttrib(GLFWwindow* window, int attrib, int value); + +/*! @brief Sets the user pointer of the specified window. + * + * This function sets the user-defined pointer of the specified window. The + * current value is retained until the window is destroyed. The initial value + * is `NULL`. + * + * @param[in] window The window whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_userptr + * @sa @ref glfwGetWindowUserPointer + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowUserPointer(GLFWwindow* window, void* pointer); + +/*! @brief Returns the user pointer of the specified window. + * + * This function returns the current value of the user-defined pointer of the + * specified window. The initial value is `NULL`. + * + * @param[in] window The window whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_userptr + * @sa @ref glfwSetWindowUserPointer + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void* glfwGetWindowUserPointer(GLFWwindow* window); + +/*! @brief Sets the position callback for the specified window. + * + * This function sets the position callback of the specified window, which is + * called when the window is moved. The callback is provided with the + * position, in screen coordinates, of the upper-left corner of the content + * area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int xpos, int ypos) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowposfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @wayland This callback will never be called, as there is no way for + * an application to know its global position. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowposfun glfwSetWindowPosCallback(GLFWwindow* window, GLFWwindowposfun callback); + +/*! @brief Sets the size callback for the specified window. + * + * This function sets the size callback of the specified window, which is + * called when the window is resized. The callback is provided with the size, + * in screen coordinates, of the content area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int width, int height) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowsizefun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowsizefun glfwSetWindowSizeCallback(GLFWwindow* window, GLFWwindowsizefun callback); + +/*! @brief Sets the close callback for the specified window. + * + * This function sets the close callback of the specified window, which is + * called when the user attempts to close the window, for example by clicking + * the close widget in the title bar. + * + * The close flag is set before this callback is called, but you can modify it + * at any time with @ref glfwSetWindowShouldClose. + * + * The close callback is not triggered by @ref glfwDestroyWindow. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowclosefun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @macos Selecting Quit from the application menu will trigger the + * close callback for all windows. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_close + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowclosefun glfwSetWindowCloseCallback(GLFWwindow* window, GLFWwindowclosefun callback); + +/*! @brief Sets the refresh callback for the specified window. + * + * This function sets the refresh callback of the specified window, which is + * called when the content area of the window needs to be redrawn, for example + * if the window has been exposed after having been covered by another window. + * + * On compositing window systems such as Aero, Compiz, Aqua or Wayland, where + * the window contents are saved off-screen, this callback may be called only + * very infrequently or never at all. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window); + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowrefreshfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_refresh + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowrefreshfun glfwSetWindowRefreshCallback(GLFWwindow* window, GLFWwindowrefreshfun callback); + +/*! @brief Sets the focus callback for the specified window. + * + * This function sets the focus callback of the specified window, which is + * called when the window gains or loses input focus. + * + * After the focus callback is called for a window that lost input focus, + * synthetic key and mouse button release events will be generated for all such + * that had been pressed. For more information, see @ref glfwSetKeyCallback + * and @ref glfwSetMouseButtonCallback. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int focused) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowfocusfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_focus + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowfocusfun glfwSetWindowFocusCallback(GLFWwindow* window, GLFWwindowfocusfun callback); + +/*! @brief Sets the iconify callback for the specified window. + * + * This function sets the iconification callback of the specified window, which + * is called when the window is iconified or restored. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int iconified) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowiconifyfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowiconifyfun glfwSetWindowIconifyCallback(GLFWwindow* window, GLFWwindowiconifyfun callback); + +/*! @brief Sets the maximize callback for the specified window. + * + * This function sets the maximization callback of the specified window, which + * is called when the window is maximized or restored. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int maximized) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowmaximizefun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_maximize + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI GLFWwindowmaximizefun glfwSetWindowMaximizeCallback(GLFWwindow* window, GLFWwindowmaximizefun callback); + +/*! @brief Sets the framebuffer resize callback for the specified window. + * + * This function sets the framebuffer resize callback of the specified window, + * which is called when the framebuffer of the specified window is resized. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int width, int height) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWframebuffersizefun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_fbsize + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWframebuffersizefun glfwSetFramebufferSizeCallback(GLFWwindow* window, GLFWframebuffersizefun callback); + +/*! @brief Sets the window content scale callback for the specified window. + * + * This function sets the window content scale callback of the specified window, + * which is called when the content scale of the specified window changes. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, float xscale, float yscale) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWwindowcontentscalefun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_scale + * @sa @ref glfwGetWindowContentScale + * + * @since Added in version 3.3. + * + * @ingroup window + */ +GLFWAPI GLFWwindowcontentscalefun glfwSetWindowContentScaleCallback(GLFWwindow* window, GLFWwindowcontentscalefun callback); + +/*! @brief Processes all pending events. + * + * This function processes only those events that are already in the event + * queue and then returns immediately. Processing events will cause the window + * and input callbacks associated with those events to be called. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. + * + * Event processing is not required for joystick input to work. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa @ref glfwWaitEvents + * @sa @ref glfwWaitEventsTimeout + * + * @since Added in version 1.0. + * + * @ingroup window + */ +GLFWAPI void glfwPollEvents(void); + +/*! @brief Waits until events are queued and processes them. + * + * This function puts the calling thread to sleep until at least one event is + * available in the event queue. Once one or more events are available, + * it behaves exactly like @ref glfwPollEvents, i.e. the events in the queue + * are processed and the function then returns immediately. Processing events + * will cause the window and input callbacks associated with those events to be + * called. + * + * Since not all events are associated with callbacks, this function may return + * without a callback having been called even if you are monitoring all + * callbacks. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. + * + * Event processing is not required for joystick input to work. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa @ref glfwPollEvents + * @sa @ref glfwWaitEventsTimeout + * + * @since Added in version 2.5. + * + * @ingroup window + */ +GLFWAPI void glfwWaitEvents(void); + +/*! @brief Waits with timeout until events are queued and processes them. + * + * This function puts the calling thread to sleep until at least one event is + * available in the event queue, or until the specified timeout is reached. If + * one or more events are available, it behaves exactly like @ref + * glfwPollEvents, i.e. the events in the queue are processed and the function + * then returns immediately. Processing events will cause the window and input + * callbacks associated with those events to be called. + * + * The timeout value must be a positive finite number. + * + * Since not all events are associated with callbacks, this function may return + * without a callback having been called even if you are monitoring all + * callbacks. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * Do not assume that callbacks you set will _only_ be called in response to + * event processing functions like this one. While it is necessary to poll for + * events, window systems that require GLFW to register callbacks of its own + * can pass events to GLFW in response to many window system function calls. + * GLFW will pass those events on to the application callbacks before + * returning. + * + * Event processing is not required for joystick input to work. + * + * @param[in] timeout The maximum amount of time, in seconds, to wait. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa @ref glfwPollEvents + * @sa @ref glfwWaitEvents + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwWaitEventsTimeout(double timeout); + +/*! @brief Posts an empty event to the event queue. + * + * This function posts an empty event from the current thread to the event + * queue, causing @ref glfwWaitEvents or @ref glfwWaitEventsTimeout to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref events + * @sa @ref glfwWaitEvents + * @sa @ref glfwWaitEventsTimeout + * + * @since Added in version 3.1. + * + * @ingroup window + */ +GLFWAPI void glfwPostEmptyEvent(void); + +/*! @brief Returns the value of an input option for the specified window. + * + * This function returns the value of an input option for the specified window. + * The mode must be one of @ref GLFW_CURSOR, @ref GLFW_STICKY_KEYS, + * @ref GLFW_STICKY_MOUSE_BUTTONS, @ref GLFW_LOCK_KEY_MODS or + * @ref GLFW_RAW_MOUSE_MOTION. + * + * @param[in] window The window to query. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS`, + * `GLFW_STICKY_MOUSE_BUTTONS`, `GLFW_LOCK_KEY_MODS` or + * `GLFW_RAW_MOUSE_MOTION`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref glfwSetInputMode + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI int glfwGetInputMode(GLFWwindow* window, int mode); + +/*! @brief Sets an input option for the specified window. + * + * This function sets an input mode option for the specified window. The mode + * must be one of @ref GLFW_CURSOR, @ref GLFW_STICKY_KEYS, + * @ref GLFW_STICKY_MOUSE_BUTTONS, @ref GLFW_LOCK_KEY_MODS or + * @ref GLFW_RAW_MOUSE_MOTION. + * + * If the mode is `GLFW_CURSOR`, the value must be one of the following cursor + * modes: + * - `GLFW_CURSOR_NORMAL` makes the cursor visible and behaving normally. + * - `GLFW_CURSOR_HIDDEN` makes the cursor invisible when it is over the + * content area of the window but does not restrict the cursor from leaving. + * - `GLFW_CURSOR_DISABLED` hides and grabs the cursor, providing virtual + * and unlimited cursor movement. This is useful for implementing for + * example 3D camera controls. + * - `GLFW_CURSOR_CAPTURED` makes the cursor visible and confines it to the + * content area of the window. + * + * If the mode is `GLFW_STICKY_KEYS`, the value must be either `GLFW_TRUE` to + * enable sticky keys, or `GLFW_FALSE` to disable it. If sticky keys are + * enabled, a key press will ensure that @ref glfwGetKey returns `GLFW_PRESS` + * the next time it is called even if the key had been released before the + * call. This is useful when you are only interested in whether keys have been + * pressed but not when or in which order. + * + * If the mode is `GLFW_STICKY_MOUSE_BUTTONS`, the value must be either + * `GLFW_TRUE` to enable sticky mouse buttons, or `GLFW_FALSE` to disable it. + * If sticky mouse buttons are enabled, a mouse button press will ensure that + * @ref glfwGetMouseButton returns `GLFW_PRESS` the next time it is called even + * if the mouse button had been released before the call. This is useful when + * you are only interested in whether mouse buttons have been pressed but not + * when or in which order. + * + * If the mode is `GLFW_LOCK_KEY_MODS`, the value must be either `GLFW_TRUE` to + * enable lock key modifier bits, or `GLFW_FALSE` to disable them. If enabled, + * callbacks that receive modifier bits will also have the @ref + * GLFW_MOD_CAPS_LOCK bit set when the event was generated with Caps Lock on, + * and the @ref GLFW_MOD_NUM_LOCK bit when Num Lock was on. + * + * If the mode is `GLFW_RAW_MOUSE_MOTION`, the value must be either `GLFW_TRUE` + * to enable raw (unscaled and unaccelerated) mouse motion when the cursor is + * disabled, or `GLFW_FALSE` to disable it. If raw motion is not supported, + * attempting to set this will emit @ref GLFW_FEATURE_UNAVAILABLE. Call @ref + * glfwRawMouseMotionSupported to check for support. + * + * @param[in] window The window whose input mode to set. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS`, + * `GLFW_STICKY_MOUSE_BUTTONS`, `GLFW_LOCK_KEY_MODS` or + * `GLFW_RAW_MOUSE_MOTION`. + * @param[in] value The new value of the specified input mode. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_PLATFORM_ERROR and @ref + * GLFW_FEATURE_UNAVAILABLE (see above). + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref glfwGetInputMode + * + * @since Added in version 3.0. Replaces `glfwEnable` and `glfwDisable`. + * + * @ingroup input + */ +GLFWAPI void glfwSetInputMode(GLFWwindow* window, int mode, int value); + +/*! @brief Returns whether raw mouse motion is supported. + * + * This function returns whether raw mouse motion is supported on the current + * system. This status does not change after GLFW has been initialized so you + * only need to check this once. If you attempt to enable raw motion on + * a system that does not support it, @ref GLFW_PLATFORM_ERROR will be emitted. + * + * Raw mouse motion is closer to the actual motion of the mouse across + * a surface. It is not affected by the scaling and acceleration applied to + * the motion of the desktop cursor. That processing is suitable for a cursor + * while raw motion is better for controlling for example a 3D camera. Because + * of this, raw mouse motion is only provided when the cursor is disabled. + * + * @return `GLFW_TRUE` if raw mouse motion is supported on the current machine, + * or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref raw_mouse_motion + * @sa @ref glfwSetInputMode + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwRawMouseMotionSupported(void); + +/*! @brief Returns the layout-specific name of the specified printable key. + * + * This function returns the name of the specified printable key, encoded as + * UTF-8. This is typically the character that key would produce without any + * modifier keys, intended for displaying key bindings to the user. For dead + * keys, it is typically the diacritic it would add to a character. + * + * __Do not use this function__ for [text input](@ref input_char). You will + * break text input for many languages even if it happens to work for yours. + * + * If the key is `GLFW_KEY_UNKNOWN`, the scancode is used to identify the key, + * otherwise the scancode is ignored. If you specify a non-printable key, or + * `GLFW_KEY_UNKNOWN` and a scancode that maps to a non-printable key, this + * function returns `NULL` but does not emit an error. + * + * This behavior allows you to always pass in the arguments in the + * [key callback](@ref input_key) without modification. + * + * The printable keys are: + * - `GLFW_KEY_APOSTROPHE` + * - `GLFW_KEY_COMMA` + * - `GLFW_KEY_MINUS` + * - `GLFW_KEY_PERIOD` + * - `GLFW_KEY_SLASH` + * - `GLFW_KEY_SEMICOLON` + * - `GLFW_KEY_EQUAL` + * - `GLFW_KEY_LEFT_BRACKET` + * - `GLFW_KEY_RIGHT_BRACKET` + * - `GLFW_KEY_BACKSLASH` + * - `GLFW_KEY_WORLD_1` + * - `GLFW_KEY_WORLD_2` + * - `GLFW_KEY_0` to `GLFW_KEY_9` + * - `GLFW_KEY_A` to `GLFW_KEY_Z` + * - `GLFW_KEY_KP_0` to `GLFW_KEY_KP_9` + * - `GLFW_KEY_KP_DECIMAL` + * - `GLFW_KEY_KP_DIVIDE` + * - `GLFW_KEY_KP_MULTIPLY` + * - `GLFW_KEY_KP_SUBTRACT` + * - `GLFW_KEY_KP_ADD` + * - `GLFW_KEY_KP_EQUAL` + * + * Names for printable keys depend on keyboard layout, while names for + * non-printable keys are the same across layouts but depend on the application + * language and should be localized along with other user interface text. + * + * @param[in] key The key to query, or `GLFW_KEY_UNKNOWN`. + * @param[in] scancode The scancode of the key to query. + * @return The UTF-8 encoded, layout-specific name of the key, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE, @ref GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @remark The contents of the returned string may change when a keyboard + * layout change event is received. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key_name + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetKeyName(int key, int scancode); + +/*! @brief Returns the platform-specific scancode of the specified key. + * + * This function returns the platform-specific scancode of the specified key. + * + * If the specified [key token](@ref keys) corresponds to a physical key not + * supported on the current platform then this method will return `-1`. + * Calling this function with anything other than a key token will return `-1` + * and generate a @ref GLFW_INVALID_ENUM error. + * + * @param[in] key Any [key token](@ref keys). + * @return The platform-specific scancode for the key, or `-1` if the key is + * not supported on the current platform or an [error](@ref error_handling) + * occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref input_key + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwGetKeyScancode(int key); + +/*! @brief Returns the last reported state of a keyboard key for the specified + * window. + * + * This function returns the last state reported for the specified key to the + * specified window. The returned state is one of `GLFW_PRESS` or + * `GLFW_RELEASE`. The action `GLFW_REPEAT` is only reported to the key callback. + * + * If the @ref GLFW_STICKY_KEYS input mode is enabled, this function returns + * `GLFW_PRESS` the first time you call it for a key that was pressed, even if + * that key has already been released. + * + * The key functions deal with physical keys, with [key tokens](@ref keys) + * named after their use on the standard US keyboard layout. If you want to + * input text, use the Unicode character callback instead. + * + * The [modifier key bit masks](@ref mods) are not key tokens and cannot be + * used with this function. + * + * __Do not use this function__ to implement [text input](@ref input_char). + * + * @param[in] window The desired window. + * @param[in] key The desired [keyboard key](@ref keys). `GLFW_KEY_UNKNOWN` is + * not a valid key for this function. + * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +GLFWAPI int glfwGetKey(GLFWwindow* window, int key); + +/*! @brief Returns the last reported state of a mouse button for the specified + * window. + * + * This function returns the last state reported for the specified mouse button + * to the specified window. The returned state is one of `GLFW_PRESS` or + * `GLFW_RELEASE`. + * + * If the @ref GLFW_STICKY_MOUSE_BUTTONS input mode is enabled, this function + * returns `GLFW_PRESS` the first time you call it for a mouse button that was + * pressed, even if that mouse button has already been released. + * + * @param[in] window The desired window. + * @param[in] button The desired [mouse button](@ref buttons). + * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_mouse_button + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); + +/*! @brief Retrieves the position of the cursor relative to the content area of + * the window. + * + * This function returns the position of the cursor, in screen coordinates, + * relative to the upper-left corner of the content area of the specified + * window. + * + * If the cursor is disabled (with `GLFW_CURSOR_DISABLED`) then the cursor + * position is unbounded and limited only by the minimum and maximum values of + * a `double`. + * + * The coordinate can be converted to their integer equivalents with the + * `floor` function. Casting directly to an integer type works for positive + * coordinates, but fails for negative ones. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] window The desired window. + * @param[out] xpos Where to store the cursor x-coordinate, relative to the + * left edge of the content area, or `NULL`. + * @param[out] ypos Where to store the cursor y-coordinate, relative to the to + * top edge of the content area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * @sa @ref glfwSetCursorPos + * + * @since Added in version 3.0. Replaces `glfwGetMousePos`. + * + * @ingroup input + */ +GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); + +/*! @brief Sets the position of the cursor, relative to the content area of the + * window. + * + * This function sets the position, in screen coordinates, of the cursor + * relative to the upper-left corner of the content area of the specified + * window. The window must have input focus. If the window does not have + * input focus when this function is called, it fails silently. + * + * __Do not use this function__ to implement things like camera controls. GLFW + * already provides the `GLFW_CURSOR_DISABLED` cursor mode that hides the + * cursor, transparently re-centers it and provides unconstrained cursor + * motion. See @ref glfwSetInputMode for more information. + * + * If the cursor mode is `GLFW_CURSOR_DISABLED` then the cursor position is + * unconstrained and limited only by the minimum and maximum values of + * a `double`. + * + * @param[in] window The desired window. + * @param[in] xpos The desired x-coordinate, relative to the left edge of the + * content area. + * @param[in] ypos The desired y-coordinate, relative to the top edge of the + * content area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_ERROR and @ref GLFW_FEATURE_UNAVAILABLE (see remarks). + * + * @remark @wayland This function will only work when the cursor mode is + * `GLFW_CURSOR_DISABLED`, otherwise it will emit @ref GLFW_FEATURE_UNAVAILABLE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * @sa @ref glfwGetCursorPos + * + * @since Added in version 3.0. Replaces `glfwSetMousePos`. + * + * @ingroup input + */ +GLFWAPI void glfwSetCursorPos(GLFWwindow* window, double xpos, double ypos); + +/*! @brief Creates a custom cursor. + * + * Creates a new custom cursor image that can be set for a window with @ref + * glfwSetCursor. The cursor can be destroyed with @ref glfwDestroyCursor. + * Any remaining cursors are destroyed by @ref glfwTerminate. + * + * The pixels are 32-bit, little-endian, non-premultiplied RGBA, i.e. eight + * bits per channel with the red channel first. They are arranged canonically + * as packed sequential rows, starting from the top-left corner. + * + * The cursor hotspot is specified in pixels, relative to the upper-left corner + * of the cursor image. Like all other coordinate systems in GLFW, the X-axis + * points to the right and the Y-axis points down. + * + * @param[in] image The desired cursor image. + * @param[in] xhot The desired x-coordinate, in pixels, of the cursor hotspot. + * @param[in] yhot The desired y-coordinate, in pixels, of the cursor hotspot. + * @return The handle of the created cursor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified image data is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * @sa @ref glfwDestroyCursor + * @sa @ref glfwCreateStandardCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcursor* glfwCreateCursor(const GLFWimage* image, int xhot, int yhot); + +/*! @brief Creates a cursor with a standard shape. + * + * Returns a cursor with a standard shape, that can be set for a window with + * @ref glfwSetCursor. The images for these cursors come from the system + * cursor theme and their exact appearance will vary between platforms. + * + * Most of these shapes are guaranteed to exist on every supported platform but + * a few may not be present. See the table below for details. + * + * Cursor shape | Windows | macOS | X11 | Wayland + * ------------------------------ | ------- | ----- | ------ | ------- + * @ref GLFW_ARROW_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_IBEAM_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_CROSSHAIR_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_POINTING_HAND_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_RESIZE_EW_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_RESIZE_NS_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_RESIZE_NWSE_CURSOR | Yes | Yes1 | Maybe2 | Maybe2 + * @ref GLFW_RESIZE_NESW_CURSOR | Yes | Yes1 | Maybe2 | Maybe2 + * @ref GLFW_RESIZE_ALL_CURSOR | Yes | Yes | Yes | Yes + * @ref GLFW_NOT_ALLOWED_CURSOR | Yes | Yes | Maybe2 | Maybe2 + * + * 1) This uses a private system API and may fail in the future. + * + * 2) This uses a newer standard that not all cursor themes support. + * + * If the requested shape is not available, this function emits a @ref + * GLFW_CURSOR_UNAVAILABLE error and returns `NULL`. + * + * @param[in] shape One of the [standard shapes](@ref shapes). + * @return A new cursor ready to use or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_CURSOR_UNAVAILABLE and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_standard + * @sa @ref glfwCreateCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcursor* glfwCreateStandardCursor(int shape); + +/*! @brief Destroys a cursor. + * + * This function destroys a cursor previously created with @ref + * glfwCreateCursor. Any remaining cursors will be destroyed by @ref + * glfwTerminate. + * + * If the specified cursor is current for any window, that window will be + * reverted to the default cursor. This does not affect the cursor mode. + * + * @param[in] cursor The cursor object to destroy. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * @sa @ref glfwCreateCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI void glfwDestroyCursor(GLFWcursor* cursor); + +/*! @brief Sets the cursor for the window. + * + * This function sets the cursor image to be used when the cursor is over the + * content area of the specified window. The set cursor will only be visible + * when the [cursor mode](@ref cursor_mode) of the window is + * `GLFW_CURSOR_NORMAL`. + * + * On some platforms, the set cursor may not be visible unless the window also + * has input focus. + * + * @param[in] window The window to set the cursor for. + * @param[in] cursor The cursor to set, or `NULL` to switch back to the default + * arrow cursor. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI void glfwSetCursor(GLFWwindow* window, GLFWcursor* cursor); + +/*! @brief Sets the key callback. + * + * This function sets the key callback of the specified window, which is called + * when a key is pressed, repeated or released. + * + * The key functions deal with physical keys, with layout independent + * [key tokens](@ref keys) named after their values in the standard US keyboard + * layout. If you want to input text, use the + * [character callback](@ref glfwSetCharCallback) instead. + * + * When a window loses input focus, it will generate synthetic key release + * events for all pressed keys with associated key tokens. You can tell these + * events from user-generated events by the fact that the synthetic ones are + * generated after the focus loss event has been processed, i.e. after the + * [window focus callback](@ref glfwSetWindowFocusCallback) has been called. + * + * The scancode of a key is specific to that platform or sometimes even to that + * machine. Scancodes are intended to allow users to bind keys that don't have + * a GLFW key token. Such keys have `key` set to `GLFW_KEY_UNKNOWN`, their + * state is not saved and so it cannot be queried with @ref glfwGetKey. + * + * Sometimes GLFW needs to generate synthetic key events, in which case the + * scancode may be zero. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new key callback, or `NULL` to remove the currently + * set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int key, int scancode, int action, int mods) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWkeyfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWkeyfun glfwSetKeyCallback(GLFWwindow* window, GLFWkeyfun callback); + +/*! @brief Sets the Unicode character callback. + * + * This function sets the character callback of the specified window, which is + * called when a Unicode character is input. + * + * The character callback is intended for Unicode text input. As it deals with + * characters, it is keyboard layout dependent, whereas the + * [key callback](@ref glfwSetKeyCallback) is not. Characters do not map 1:1 + * to physical keys, as a key may produce zero, one or more characters. If you + * want to know whether a specific physical key was pressed or released, see + * the key callback instead. + * + * The character callback behaves as system text input normally does and will + * not be called if modifier keys are held down that would prevent normal text + * input on that platform, for example a Super (Command) key on macOS or Alt key + * on Windows. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, unsigned int codepoint) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWcharfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_char + * + * @since Added in version 2.4. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWcharfun glfwSetCharCallback(GLFWwindow* window, GLFWcharfun callback); + +/*! @brief Sets the Unicode character with modifiers callback. + * + * This function sets the character with modifiers callback of the specified + * window, which is called when a Unicode character is input regardless of what + * modifier keys are used. + * + * The character with modifiers callback is intended for implementing custom + * Unicode character input. For regular Unicode text input, see the + * [character callback](@ref glfwSetCharCallback). Like the character + * callback, the character with modifiers callback deals with characters and is + * keyboard layout dependent. Characters do not map 1:1 to physical keys, as + * a key may produce zero, one or more characters. If you want to know whether + * a specific physical key was pressed or released, see the + * [key callback](@ref glfwSetKeyCallback) instead. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or an + * [error](@ref error_handling) occurred. + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, unsigned int codepoint, int mods) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWcharmodsfun). + * + * @deprecated Scheduled for removal in version 4.0. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_char + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcharmodsfun glfwSetCharModsCallback(GLFWwindow* window, GLFWcharmodsfun callback); + +/*! @brief Sets the mouse button callback. + * + * This function sets the mouse button callback of the specified window, which + * is called when a mouse button is pressed or released. + * + * When a window loses input focus, it will generate synthetic mouse button + * release events for all pressed mouse buttons. You can tell these events + * from user-generated events by the fact that the synthetic ones are generated + * after the focus loss event has been processed, i.e. after the + * [window focus callback](@ref glfwSetWindowFocusCallback) has been called. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int button, int action, int mods) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWmousebuttonfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_mouse_button + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWmousebuttonfun glfwSetMouseButtonCallback(GLFWwindow* window, GLFWmousebuttonfun callback); + +/*! @brief Sets the cursor position callback. + * + * This function sets the cursor position callback of the specified window, + * which is called when the cursor is moved. The callback is provided with the + * position, in screen coordinates, relative to the upper-left corner of the + * content area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, double xpos, double ypos); + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWcursorposfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * + * @since Added in version 3.0. Replaces `glfwSetMousePosCallback`. + * + * @ingroup input + */ +GLFWAPI GLFWcursorposfun glfwSetCursorPosCallback(GLFWwindow* window, GLFWcursorposfun callback); + +/*! @brief Sets the cursor enter/leave callback. + * + * This function sets the cursor boundary crossing callback of the specified + * window, which is called when the cursor enters or leaves the content area of + * the window. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int entered) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWcursorenterfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_enter + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI GLFWcursorenterfun glfwSetCursorEnterCallback(GLFWwindow* window, GLFWcursorenterfun callback); + +/*! @brief Sets the scroll callback. + * + * This function sets the scroll callback of the specified window, which is + * called when a scrolling device is used, such as a mouse wheel or scrolling + * area of a touchpad. + * + * The scroll callback receives all scrolling input, like that from a mouse + * wheel or a touchpad scrolling area. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new scroll callback, or `NULL` to remove the + * currently set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, double xoffset, double yoffset) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWscrollfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref scrolling + * + * @since Added in version 3.0. Replaces `glfwSetMouseWheelCallback`. + * + * @ingroup input + */ +GLFWAPI GLFWscrollfun glfwSetScrollCallback(GLFWwindow* window, GLFWscrollfun callback); + +/*! @brief Sets the path drop callback. + * + * This function sets the path drop callback of the specified window, which is + * called when one or more dragged paths are dropped on the window. + * + * Because the path array and its strings may have been generated specifically + * for that event, they are not guaranteed to be valid after the callback has + * returned. If you wish to use them after the callback returns, you need to + * make a deep copy. + * + * @param[in] window The window whose callback to set. + * @param[in] callback The new file drop callback, or `NULL` to remove the + * currently set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(GLFWwindow* window, int path_count, const char* paths[]) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWdropfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref path_drop + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWdropfun glfwSetDropCallback(GLFWwindow* window, GLFWdropfun callback); + +/*! @brief Returns whether the specified joystick is present. + * + * This function returns whether the specified joystick is present. + * + * There is no need to call this function before other functions that accept + * a joystick ID, as they all check for presence before performing any other + * work. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return `GLFW_TRUE` if the joystick is present, or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick + * + * @since Added in version 3.0. Replaces `glfwGetJoystickParam`. + * + * @ingroup input + */ +GLFWAPI int glfwJoystickPresent(int jid); + +/*! @brief Returns the values of all axes of the specified joystick. + * + * This function returns the values of all axes of the specified joystick. + * Each element in the array is a value between -1.0 and 1.0. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of axis values in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of axis values, or `NULL` if the joystick is not present or + * an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_axis + * + * @since Added in version 3.0. Replaces `glfwGetJoystickPos`. + * + * @ingroup input + */ +GLFWAPI const float* glfwGetJoystickAxes(int jid, int* count); + +/*! @brief Returns the state of all buttons of the specified joystick. + * + * This function returns the state of all buttons of the specified joystick. + * Each element in the array is either `GLFW_PRESS` or `GLFW_RELEASE`. + * + * For backward compatibility with earlier versions that did not have @ref + * glfwGetJoystickHats, the button array also includes all hats, each + * represented as four buttons. The hats are in the same order as returned by + * __glfwGetJoystickHats__ and are in the order _up_, _right_, _down_ and + * _left_. To disable these extra buttons, set the @ref + * GLFW_JOYSTICK_HAT_BUTTONS init hint before initialization. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of button states in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of button states, or `NULL` if the joystick is not present + * or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_button + * + * @since Added in version 2.2. + * @glfw3 Changed to return a dynamic array. + * + * @ingroup input + */ +GLFWAPI const unsigned char* glfwGetJoystickButtons(int jid, int* count); + +/*! @brief Returns the state of all hats of the specified joystick. + * + * This function returns the state of all hats of the specified joystick. + * Each element in the array is one of the following values: + * + * Name | Value + * ---- | ----- + * `GLFW_HAT_CENTERED` | 0 + * `GLFW_HAT_UP` | 1 + * `GLFW_HAT_RIGHT` | 2 + * `GLFW_HAT_DOWN` | 4 + * `GLFW_HAT_LEFT` | 8 + * `GLFW_HAT_RIGHT_UP` | `GLFW_HAT_RIGHT` \| `GLFW_HAT_UP` + * `GLFW_HAT_RIGHT_DOWN` | `GLFW_HAT_RIGHT` \| `GLFW_HAT_DOWN` + * `GLFW_HAT_LEFT_UP` | `GLFW_HAT_LEFT` \| `GLFW_HAT_UP` + * `GLFW_HAT_LEFT_DOWN` | `GLFW_HAT_LEFT` \| `GLFW_HAT_DOWN` + * + * The diagonal directions are bitwise combinations of the primary (up, right, + * down and left) directions and you can test for these individually by ANDing + * it with the corresponding direction. + * + * @code + * if (hats[2] & GLFW_HAT_RIGHT) + * { + * // State of hat 2 could be right-up, right or right-down + * } + * @endcode + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of hat states in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of hat states, or `NULL` if the joystick is not present + * or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, this function is called again for that joystick or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_hat + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI const unsigned char* glfwGetJoystickHats(int jid, int* count); + +/*! @brief Returns the name of the specified joystick. + * + * This function returns the name, encoded as UTF-8, of the specified joystick. + * The returned string is allocated and freed by GLFW. You should not free it + * yourself. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded name of the joystick, or `NULL` if the joystick + * is not present or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_name + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetJoystickName(int jid); + +/*! @brief Returns the SDL compatible GUID of the specified joystick. + * + * This function returns the SDL compatible GUID, as a UTF-8 encoded + * hexadecimal string, of the specified joystick. The returned string is + * allocated and freed by GLFW. You should not free it yourself. + * + * The GUID is what connects a joystick to a gamepad mapping. A connected + * joystick will always have a GUID even if there is no gamepad mapping + * assigned to it. + * + * If the specified joystick is not present this function will return `NULL` + * but will not generate an error. This can be used instead of first calling + * @ref glfwJoystickPresent. + * + * The GUID uses the format introduced in SDL 2.0.5. This GUID tries to + * uniquely identify the make and model of a joystick but does not identify + * a specific unit, e.g. all wired Xbox 360 controllers will have the same + * GUID on that platform. The GUID for a unit may vary between platforms + * depending on what hardware information the platform specific APIs provide. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded GUID of the joystick, or `NULL` if the joystick + * is not present or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetJoystickGUID(int jid); + +/*! @brief Sets the user pointer of the specified joystick. + * + * This function sets the user-defined pointer of the specified joystick. The + * current value is retained until the joystick is disconnected. The initial + * value is `NULL`. + * + * This function may be called from the joystick callback, even for a joystick + * that is being disconnected. + * + * @param[in] jid The joystick whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref joystick_userptr + * @sa @ref glfwGetJoystickUserPointer + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI void glfwSetJoystickUserPointer(int jid, void* pointer); + +/*! @brief Returns the user pointer of the specified joystick. + * + * This function returns the current value of the user-defined pointer of the + * specified joystick. The initial value is `NULL`. + * + * This function may be called from the joystick callback, even for a joystick + * that is being disconnected. + * + * @param[in] jid The joystick whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref joystick_userptr + * @sa @ref glfwSetJoystickUserPointer + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI void* glfwGetJoystickUserPointer(int jid); + +/*! @brief Returns whether the specified joystick has a gamepad mapping. + * + * This function returns whether the specified joystick is both present and has + * a gamepad mapping. + * + * If the specified joystick is present but does not have a gamepad mapping + * this function will return `GLFW_FALSE` but will not generate an error. Call + * @ref glfwJoystickPresent to check if a joystick is present regardless of + * whether it has a mapping. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return `GLFW_TRUE` if a joystick is both present and has a gamepad mapping, + * or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwGetGamepadState + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwJoystickIsGamepad(int jid); + +/*! @brief Sets the joystick configuration callback. + * + * This function sets the joystick configuration callback, or removes the + * currently set callback. This is called when a joystick is connected to or + * disconnected from the system. + * + * For joystick connection and disconnection events to be delivered on all + * platforms, you need to call one of the [event processing](@ref events) + * functions. Joystick disconnection may also be detected and the callback + * called by joystick functions. The function will then return whatever it + * returns if the joystick is not present. + * + * @param[in] callback The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @callback_signature + * @code + * void function_name(int jid, int event) + * @endcode + * For more information about the callback parameters, see the + * [function pointer type](@ref GLFWjoystickfun). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_event + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI GLFWjoystickfun glfwSetJoystickCallback(GLFWjoystickfun callback); + +/*! @brief Adds the specified SDL_GameControllerDB gamepad mappings. + * + * This function parses the specified ASCII encoded string and updates the + * internal list with any gamepad mappings it finds. This string may + * contain either a single gamepad mapping or many mappings separated by + * newlines. The parser supports the full format of the `gamecontrollerdb.txt` + * source file including empty lines and comments. + * + * See @ref gamepad_mapping for a description of the format. + * + * If there is already a gamepad mapping for a given GUID in the internal list, + * it will be replaced by the one passed to this function. If the library is + * terminated and re-initialized the internal list will revert to the built-in + * default. + * + * @param[in] string The string containing the gamepad mappings. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_VALUE. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwJoystickIsGamepad + * @sa @ref glfwGetGamepadName + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwUpdateGamepadMappings(const char* string); + +/*! @brief Returns the human-readable gamepad name for the specified joystick. + * + * This function returns the human-readable name of the gamepad from the + * gamepad mapping assigned to the specified joystick. + * + * If the specified joystick is not present or does not have a gamepad mapping + * this function will return `NULL` but will not generate an error. Call + * @ref glfwJoystickPresent to check whether it is present regardless of + * whether it has a mapping. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded name of the gamepad, or `NULL` if the + * joystick is not present, does not have a mapping or an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref GLFW_INVALID_ENUM. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, the gamepad mappings are updated or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwJoystickIsGamepad + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetGamepadName(int jid); + +/*! @brief Retrieves the state of the specified joystick remapped as a gamepad. + * + * This function retrieves the state of the specified joystick remapped to + * an Xbox-like gamepad. + * + * If the specified joystick is not present or does not have a gamepad mapping + * this function will return `GLFW_FALSE` but will not generate an error. Call + * @ref glfwJoystickPresent to check whether it is present regardless of + * whether it has a mapping. + * + * The Guide button may not be available for input as it is often hooked by the + * system or the Steam client. + * + * Not all devices have all the buttons or axes provided by @ref + * GLFWgamepadstate. Unavailable buttons and axes will always report + * `GLFW_RELEASE` and 0.0 respectively. + * + * @param[in] jid The [joystick](@ref joysticks) to query. + * @param[out] state The gamepad input state of the joystick. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if no joystick is + * connected, it has no gamepad mapping or an [error](@ref error_handling) + * occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref gamepad + * @sa @ref glfwUpdateGamepadMappings + * @sa @ref glfwJoystickIsGamepad + * + * @since Added in version 3.3. + * + * @ingroup input + */ +GLFWAPI int glfwGetGamepadState(int jid, GLFWgamepadstate* state); + +/*! @brief Sets the clipboard to the specified string. + * + * This function sets the system clipboard to the specified, UTF-8 encoded + * string. + * + * @param[in] window Deprecated. Any valid window or `NULL`. + * @param[in] string A UTF-8 encoded string. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @win32 The clipboard on Windows has a single global lock for reading and + * writing. GLFW tries to acquire it a few times, which is almost always enough. If it + * cannot acquire the lock then this function emits @ref GLFW_PLATFORM_ERROR and returns. + * It is safe to try this multiple times. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa @ref glfwGetClipboardString + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI void glfwSetClipboardString(GLFWwindow* window, const char* string); + +/*! @brief Returns the contents of the clipboard as a string. + * + * This function returns the contents of the system clipboard, if it contains + * or is convertible to a UTF-8 encoded string. If the clipboard is empty or + * if its contents cannot be converted, `NULL` is returned and a @ref + * GLFW_FORMAT_UNAVAILABLE error is generated. + * + * @param[in] window Deprecated. Any valid window or `NULL`. + * @return The contents of the clipboard as a UTF-8 encoded string, or `NULL` + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_FORMAT_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @remark @win32 The clipboard on Windows has a single global lock for reading and + * writing. GLFW tries to acquire it a few times, which is almost always enough. If it + * cannot acquire the lock then this function emits @ref GLFW_PLATFORM_ERROR and returns. + * It is safe to try this multiple times. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetClipboardString or @ref glfwSetClipboardString, or until the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa @ref glfwSetClipboardString + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetClipboardString(GLFWwindow* window); + +/*! @brief Returns the GLFW time. + * + * This function returns the current GLFW time, in seconds. Unless the time + * has been set using @ref glfwSetTime it measures time elapsed since GLFW was + * initialized. + * + * This function and @ref glfwSetTime are helper functions on top of @ref + * glfwGetTimerFrequency and @ref glfwGetTimerValue. + * + * The resolution of the timer is system dependent, but is usually on the order + * of a few micro- or nanoseconds. It uses the highest-resolution monotonic + * time source on each operating system. + * + * @return The current time, in seconds, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal base time is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwSetTime. + * + * @sa @ref time + * + * @since Added in version 1.0. + * + * @ingroup input + */ +GLFWAPI double glfwGetTime(void); + +/*! @brief Sets the GLFW time. + * + * This function sets the current GLFW time, in seconds. The value must be + * a positive finite number less than or equal to 18446744073.0, which is + * approximately 584.5 years. + * + * This function and @ref glfwGetTime are helper functions on top of @ref + * glfwGetTimerFrequency and @ref glfwGetTimerValue. + * + * @param[in] time The new value, in seconds. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_VALUE. + * + * @remark The upper limit of GLFW time is calculated as + * floor((264 - 1) / 109) and is due to implementations + * storing nanoseconds in 64 bits. The limit may be increased in the future. + * + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal base time is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwGetTime. + * + * @sa @ref time + * + * @since Added in version 2.2. + * + * @ingroup input + */ +GLFWAPI void glfwSetTime(double time); + +/*! @brief Returns the current value of the raw timer. + * + * This function returns the current value of the raw timer, measured in + * 1 / frequency seconds. To get the frequency, call @ref + * glfwGetTimerFrequency. + * + * @return The value of the timer, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa @ref glfwGetTimerFrequency + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerValue(void); + +/*! @brief Returns the frequency, in Hz, of the raw timer. + * + * This function returns the frequency, in Hz, of the raw timer. + * + * @return The frequency of the timer, in Hz, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa @ref glfwGetTimerValue + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerFrequency(void); + +/*! @brief Makes the context of the specified window current for the calling + * thread. + * + * This function makes the OpenGL or OpenGL ES context of the specified window + * current on the calling thread. It can also detach the current context from + * the calling thread without making a new one current by passing in `NULL`. + * + * A context must only be made current on a single thread at a time and each + * thread can have only a single current context at a time. Making a context + * current detaches any previously current context on the calling thread. + * + * When moving a context between threads, you must detach it (make it + * non-current) on the old thread before making it current on the new one. + * + * By default, making a context non-current implicitly forces a pipeline flush. + * On machines that support `GL_KHR_context_flush_control`, you can control + * whether a context performs this flush by setting the + * [GLFW_CONTEXT_RELEASE_BEHAVIOR](@ref GLFW_CONTEXT_RELEASE_BEHAVIOR_hint) + * hint. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. + * + * @param[in] window The window whose context to make current, or `NULL` to + * detach the current context. + * + * @remarks If the previously current context was created via a different + * context creation API than the one passed to this function, GLFW will still + * detach the previous one from its API before making the new one current. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_current + * @sa @ref glfwGetCurrentContext + * + * @since Added in version 3.0. + * + * @ingroup context + */ +GLFWAPI void glfwMakeContextCurrent(GLFWwindow* window); + +/*! @brief Returns the window whose context is current on the calling thread. + * + * This function returns the window whose OpenGL or OpenGL ES context is + * current on the calling thread. + * + * @return The window whose context is current, or `NULL` if no window's + * context is current. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_current + * @sa @ref glfwMakeContextCurrent + * + * @since Added in version 3.0. + * + * @ingroup context + */ +GLFWAPI GLFWwindow* glfwGetCurrentContext(void); + +/*! @brief Swaps the front and back buffers of the specified window. + * + * This function swaps the front and back buffers of the specified window when + * rendering with OpenGL or OpenGL ES. If the swap interval is greater than + * zero, the GPU driver waits the specified number of screen updates before + * swapping the buffers. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see `vkQueuePresentKHR` instead. + * + * @param[in] window The window whose buffers to swap. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark __EGL:__ The context of the specified window must be current on the + * calling thread. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref buffer_swap + * @sa @ref glfwSwapInterval + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSwapBuffers(GLFWwindow* window); + +/*! @brief Sets the swap interval for the current context. + * + * This function sets the swap interval for the current OpenGL or OpenGL ES + * context, i.e. the number of screen updates to wait from the time @ref + * glfwSwapBuffers was called before swapping the buffers and returning. This + * is sometimes called _vertical synchronization_, _vertical retrace + * synchronization_ or just _vsync_. + * + * A context that supports either of the `WGL_EXT_swap_control_tear` and + * `GLX_EXT_swap_control_tear` extensions also accepts _negative_ swap + * intervals, which allows the driver to swap immediately even if a frame + * arrives a little bit late. You can check for these extensions with @ref + * glfwExtensionSupported. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see the present mode of your swapchain instead. + * + * @param[in] interval The minimum number of screen updates to wait for + * until the buffers are swapped by @ref glfwSwapBuffers. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark This function is not called during context creation, leaving the + * swap interval set to whatever is the default for that API. This is done + * because some swap interval extensions used by GLFW do not allow the swap + * interval to be reset to zero once it has been set to a non-zero value. + * + * @remark Some GPU drivers do not honor the requested swap interval, either + * because of a user setting that overrides the application's request or due to + * bugs in the driver. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref buffer_swap + * @sa @ref glfwSwapBuffers + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI void glfwSwapInterval(int interval); + +/*! @brief Returns whether the specified extension is available. + * + * This function returns whether the specified + * [API extension](@ref context_glext) is supported by the current OpenGL or + * OpenGL ES context. It searches both for client API extension and context + * creation API extensions. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * As this functions retrieves and searches one or more extension strings each + * call, it is recommended that you cache its results if it is going to be used + * frequently. The extension strings will not change during the lifetime of + * a context, so there is no danger in doing this. + * + * This function does not apply to Vulkan. If you are using Vulkan, see @ref + * glfwGetRequiredInstanceExtensions, `vkEnumerateInstanceExtensionProperties` + * and `vkEnumerateDeviceExtensionProperties` instead. + * + * @param[in] extension The ASCII encoded name of the extension. + * @return `GLFW_TRUE` if the extension is available, or `GLFW_FALSE` + * otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT, @ref GLFW_INVALID_VALUE and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_glext + * @sa @ref glfwGetProcAddress + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI int glfwExtensionSupported(const char* extension); + +/*! @brief Returns the address of the specified function for the current + * context. + * + * This function returns the address of the specified OpenGL or OpenGL ES + * [core or extension function](@ref context_glext), if it is supported + * by the current context. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see @ref glfwGetInstanceProcAddress, `vkGetInstanceProcAddr` and + * `vkGetDeviceProcAddr` instead. + * + * @param[in] procname The ASCII encoded name of the function. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark The address of a given function is not guaranteed to be the same + * between contexts. + * + * @remark This function may return a non-`NULL` address despite the + * associated version or extension not being available. Always check the + * context version or extension string first. + * + * @pointer_lifetime The returned function pointer is valid until the context + * is destroyed or the library is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_glext + * @sa @ref glfwExtensionSupported + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI GLFWglproc glfwGetProcAddress(const char* procname); + +/*! @brief Returns whether the Vulkan loader and an ICD have been found. + * + * This function returns whether the Vulkan loader and any minimally functional + * ICD have been found. + * + * The availability of a Vulkan loader and even an ICD does not by itself guarantee that + * surface creation or even instance creation is possible. Call @ref + * glfwGetRequiredInstanceExtensions to check whether the extensions necessary for Vulkan + * surface creation are available and @ref glfwGetPhysicalDevicePresentationSupport to + * check whether a queue family of a physical device supports image presentation. + * + * @return `GLFW_TRUE` if Vulkan is minimally available, or `GLFW_FALSE` + * otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_support + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwVulkanSupported(void); + +/*! @brief Returns the Vulkan instance extensions required by GLFW. + * + * This function returns an array of names of Vulkan instance extensions required + * by GLFW for creating Vulkan surfaces for GLFW windows. If successful, the + * list will always contain `VK_KHR_surface`, so if you don't require any + * additional extensions you can pass this list directly to the + * `VkInstanceCreateInfo` struct. + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available. + * + * If Vulkan is available but no set of extensions allowing window surface + * creation was found, this function returns `NULL`. You may still use Vulkan + * for off-screen rendering and compute work. + * + * @param[out] count Where to store the number of extensions in the returned + * array. This is set to zero if an error occurred. + * @return An array of ASCII encoded extension names, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @remark Additional extensions may be required by future versions of GLFW. + * You should check if any extensions you wish to enable are already in the + * returned array, as it is an error to specify an extension more than once in + * the `VkInstanceCreateInfo` struct. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * library is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_ext + * @sa @ref glfwCreateWindowSurface + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI const char** glfwGetRequiredInstanceExtensions(uint32_t* count); + +#if defined(VK_VERSION_1_0) + +/*! @brief Returns the address of the specified Vulkan instance function. + * + * This function returns the address of the specified Vulkan core or extension + * function for the specified instance. If instance is set to `NULL` it can + * return any function exported from the Vulkan loader, including at least the + * following functions: + * + * - `vkEnumerateInstanceExtensionProperties` + * - `vkEnumerateInstanceLayerProperties` + * - `vkCreateInstance` + * - `vkGetInstanceProcAddr` + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available. + * + * This function is equivalent to calling `vkGetInstanceProcAddr` with + * a platform-specific query of the Vulkan loader as a fallback. + * + * @param[in] instance The Vulkan instance to query, or `NULL` to retrieve + * functions related to instance creation. + * @param[in] procname The ASCII encoded name of the function. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @pointer_lifetime The returned function pointer is valid until the library + * is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_proc + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI GLFWvkproc glfwGetInstanceProcAddress(VkInstance instance, const char* procname); + +/*! @brief Returns whether the specified queue family can present images. + * + * This function returns whether the specified queue family of the specified + * physical device supports presentation to the platform GLFW was built for. + * + * If Vulkan or the required window surface creation instance extensions are + * not available on the machine, or if the specified instance was not created + * with the required extensions, this function returns `GLFW_FALSE` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is at least minimally available and @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * @param[in] instance The instance that the physical device belongs to. + * @param[in] device The physical device that the queue family belongs to. + * @param[in] queuefamily The index of the queue family to query. + * @return `GLFW_TRUE` if the queue family supports presentation, or + * `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @remark @macos This function currently always returns `GLFW_TRUE`, as the + * `VK_MVK_macos_surface` and `VK_EXT_metal_surface` extensions do not provide + * a `vkGetPhysicalDevice*PresentationSupport` type function. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_present + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwGetPhysicalDevicePresentationSupport(VkInstance instance, VkPhysicalDevice device, uint32_t queuefamily); + +/*! @brief Creates a Vulkan surface for the specified window. + * + * This function creates a Vulkan surface for the specified window. + * + * If the Vulkan loader or at least one minimally functional ICD were not found, + * this function returns `VK_ERROR_INITIALIZATION_FAILED` and generates a @ref + * GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported to check whether + * Vulkan is at least minimally available. + * + * If the required window surface creation instance extensions are not + * available or if the specified instance was not created with these extensions + * enabled, this function returns `VK_ERROR_EXTENSION_NOT_PRESENT` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * The window surface cannot be shared with another API so the window must + * have been created with the [client api hint](@ref GLFW_CLIENT_API_attrib) + * set to `GLFW_NO_API` otherwise it generates a @ref GLFW_INVALID_VALUE error + * and returns `VK_ERROR_NATIVE_WINDOW_IN_USE_KHR`. + * + * The window surface must be destroyed before the specified Vulkan instance. + * It is the responsibility of the caller to destroy the window surface. GLFW + * does not destroy it for you. Call `vkDestroySurfaceKHR` to destroy the + * surface. + * + * @param[in] instance The Vulkan instance to create the surface in. + * @param[in] window The window to create the surface for. + * @param[in] allocator The allocator to use, or `NULL` to use the default + * allocator. + * @param[out] surface Where to store the handle of the surface. This is set + * to `VK_NULL_HANDLE` if an error occurred. + * @return `VK_SUCCESS` if successful, or a Vulkan error code if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE, @ref GLFW_PLATFORM_ERROR and @ref GLFW_INVALID_VALUE + * + * @remark If an error occurs before the creation call is made, GLFW returns + * the Vulkan error code most appropriate for the error. Appropriate use of + * @ref glfwVulkanSupported and @ref glfwGetRequiredInstanceExtensions should + * eliminate almost all occurrences of these errors. + * + * @remark @macos GLFW prefers the `VK_EXT_metal_surface` extension, with the + * `VK_MVK_macos_surface` extension as a fallback. The name of the selected + * extension, if any, is included in the array returned by @ref + * glfwGetRequiredInstanceExtensions. + * + * @remark @macos This function creates and sets a `CAMetalLayer` instance for + * the window content view, which is required for MoltenVK to function. + * + * @remark @x11 By default GLFW prefers the `VK_KHR_xcb_surface` extension, + * with the `VK_KHR_xlib_surface` extension as a fallback. You can make + * `VK_KHR_xlib_surface` the preferred extension by setting the + * [GLFW_X11_XCB_VULKAN_SURFACE](@ref GLFW_X11_XCB_VULKAN_SURFACE_hint) init + * hint. The name of the selected extension, if any, is included in the array + * returned by @ref glfwGetRequiredInstanceExtensions. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_surface + * @sa @ref glfwGetRequiredInstanceExtensions + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI VkResult glfwCreateWindowSurface(VkInstance instance, GLFWwindow* window, const VkAllocationCallbacks* allocator, VkSurfaceKHR* surface); + +#endif /*VK_VERSION_1_0*/ + + +/************************************************************************* + * Global definition cleanup + *************************************************************************/ + +/* ------------------- BEGIN SYSTEM/COMPILER SPECIFIC -------------------- */ + +#ifdef GLFW_WINGDIAPI_DEFINED + #undef WINGDIAPI + #undef GLFW_WINGDIAPI_DEFINED +#endif + +#ifdef GLFW_CALLBACK_DEFINED + #undef CALLBACK + #undef GLFW_CALLBACK_DEFINED +#endif + +/* Some OpenGL related headers need GLAPIENTRY, but it is unconditionally + * defined by some gl.h variants (OpenBSD) so define it after if needed. + */ +#ifndef GLAPIENTRY + #define GLAPIENTRY APIENTRY + #define GLFW_GLAPIENTRY_DEFINED +#endif + +/* -------------------- END SYSTEM/COMPILER SPECIFIC --------------------- */ + + +#ifdef __cplusplus +} +#endif + +#endif /* _glfw3_h_ */ + diff --git a/TSE_GlfwImpl/include/GLFW/glfw3native.h b/TSE_GlfwImpl/include/GLFW/glfw3native.h new file mode 100644 index 0000000..ae47325 --- /dev/null +++ b/TSE_GlfwImpl/include/GLFW/glfw3native.h @@ -0,0 +1,663 @@ +/************************************************************************* + * GLFW 3.4 - www.glfw.org + * A library for OpenGL, window and input + *------------------------------------------------------------------------ + * Copyright (c) 2002-2006 Marcus Geelnard + * Copyright (c) 2006-2018 Camilla Löwy + * + * This software is provided 'as-is', without any express or implied + * warranty. In no event will the authors be held liable for any damages + * arising from the use of this software. + * + * Permission is granted to anyone to use this software for any purpose, + * including commercial applications, and to alter it and redistribute it + * freely, subject to the following restrictions: + * + * 1. The origin of this software must not be misrepresented; you must not + * claim that you wrote the original software. If you use this software + * in a product, an acknowledgment in the product documentation would + * be appreciated but is not required. + * + * 2. Altered source versions must be plainly marked as such, and must not + * be misrepresented as being the original software. + * + * 3. This notice may not be removed or altered from any source + * distribution. + * + *************************************************************************/ + +#ifndef _glfw3_native_h_ +#define _glfw3_native_h_ + +#ifdef __cplusplus +extern "C" { +#endif + + +/************************************************************************* + * Doxygen documentation + *************************************************************************/ + +/*! @file glfw3native.h + * @brief The header of the native access functions. + * + * This is the header file of the native access functions. See @ref native for + * more information. + */ +/*! @defgroup native Native access + * @brief Functions related to accessing native handles. + * + * **By using the native access functions you assert that you know what you're + * doing and how to fix problems caused by using them. If you don't, you + * shouldn't be using them.** + * + * Before the inclusion of @ref glfw3native.h, you may define zero or more + * window system API macro and zero or more context creation API macros. + * + * The chosen backends must match those the library was compiled for. Failure + * to do this will cause a link-time error. + * + * The available window API macros are: + * * `GLFW_EXPOSE_NATIVE_WIN32` + * * `GLFW_EXPOSE_NATIVE_COCOA` + * * `GLFW_EXPOSE_NATIVE_X11` + * * `GLFW_EXPOSE_NATIVE_WAYLAND` + * + * The available context API macros are: + * * `GLFW_EXPOSE_NATIVE_WGL` + * * `GLFW_EXPOSE_NATIVE_NSGL` + * * `GLFW_EXPOSE_NATIVE_GLX` + * * `GLFW_EXPOSE_NATIVE_EGL` + * * `GLFW_EXPOSE_NATIVE_OSMESA` + * + * These macros select which of the native access functions that are declared + * and which platform-specific headers to include. It is then up your (by + * definition platform-specific) code to handle which of these should be + * defined. + * + * If you do not want the platform-specific headers to be included, define + * `GLFW_NATIVE_INCLUDE_NONE` before including the @ref glfw3native.h header. + * + * @code + * #define GLFW_EXPOSE_NATIVE_WIN32 + * #define GLFW_EXPOSE_NATIVE_WGL + * #define GLFW_NATIVE_INCLUDE_NONE + * #include + * @endcode + */ + + +/************************************************************************* + * System headers and types + *************************************************************************/ + +#if !defined(GLFW_NATIVE_INCLUDE_NONE) + + #if defined(GLFW_EXPOSE_NATIVE_WIN32) || defined(GLFW_EXPOSE_NATIVE_WGL) + /* This is a workaround for the fact that glfw3.h needs to export APIENTRY (for + * example to allow applications to correctly declare a GL_KHR_debug callback) + * but windows.h assumes no one will define APIENTRY before it does + */ + #if defined(GLFW_APIENTRY_DEFINED) + #undef APIENTRY + #undef GLFW_APIENTRY_DEFINED + #endif + #include + #endif + + #if defined(GLFW_EXPOSE_NATIVE_COCOA) || defined(GLFW_EXPOSE_NATIVE_NSGL) + #if defined(__OBJC__) + #import + #else + #include + #include + #endif + #endif + + #if defined(GLFW_EXPOSE_NATIVE_X11) || defined(GLFW_EXPOSE_NATIVE_GLX) + #include + #include + #endif + + #if defined(GLFW_EXPOSE_NATIVE_WAYLAND) + #include + #endif + + #if defined(GLFW_EXPOSE_NATIVE_WGL) + /* WGL is declared by windows.h */ + #endif + #if defined(GLFW_EXPOSE_NATIVE_NSGL) + /* NSGL is declared by Cocoa.h */ + #endif + #if defined(GLFW_EXPOSE_NATIVE_GLX) + /* This is a workaround for the fact that glfw3.h defines GLAPIENTRY because by + * default it also acts as an OpenGL header + * However, glx.h will include gl.h, which will define it unconditionally + */ + #if defined(GLFW_GLAPIENTRY_DEFINED) + #undef GLAPIENTRY + #undef GLFW_GLAPIENTRY_DEFINED + #endif + #include + #endif + #if defined(GLFW_EXPOSE_NATIVE_EGL) + #include + #endif + #if defined(GLFW_EXPOSE_NATIVE_OSMESA) + /* This is a workaround for the fact that glfw3.h defines GLAPIENTRY because by + * default it also acts as an OpenGL header + * However, osmesa.h will include gl.h, which will define it unconditionally + */ + #if defined(GLFW_GLAPIENTRY_DEFINED) + #undef GLAPIENTRY + #undef GLFW_GLAPIENTRY_DEFINED + #endif + #include + #endif + +#endif /*GLFW_NATIVE_INCLUDE_NONE*/ + + +/************************************************************************* + * Functions + *************************************************************************/ + +#if defined(GLFW_EXPOSE_NATIVE_WIN32) +/*! @brief Returns the adapter device name of the specified monitor. + * + * @return The UTF-8 encoded adapter device name (for example `\\.\DISPLAY1`) + * of the specified monitor, or `NULL` if an [error](@ref error_handling) + * occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetWin32Adapter(GLFWmonitor* monitor); + +/*! @brief Returns the display device name of the specified monitor. + * + * @return The UTF-8 encoded display device name (for example + * `\\.\DISPLAY1\Monitor0`) of the specified monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetWin32Monitor(GLFWmonitor* monitor); + +/*! @brief Returns the `HWND` of the specified window. + * + * @return The `HWND` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @remark The `HDC` associated with the window can be queried with the + * [GetDC](https://docs.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-getdc) + * function. + * @code + * HDC dc = GetDC(glfwGetWin32Window(window)); + * @endcode + * This DC is private and does not need to be released. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI HWND glfwGetWin32Window(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WGL) +/*! @brief Returns the `HGLRC` of the specified window. + * + * @return The `HGLRC` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_UNAVAILABLE and @ref GLFW_NO_WINDOW_CONTEXT. + * + * @remark The `HDC` associated with the window can be queried with the + * [GetDC](https://docs.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-getdc) + * function. + * @code + * HDC dc = GetDC(glfwGetWin32Window(window)); + * @endcode + * This DC is private and does not need to be released. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI HGLRC glfwGetWGLContext(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_COCOA) +/*! @brief Returns the `CGDirectDisplayID` of the specified monitor. + * + * @return The `CGDirectDisplayID` of the specified monitor, or + * `kCGNullDirectDisplay` if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI CGDirectDisplayID glfwGetCocoaMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the `NSWindow` of the specified window. + * + * @return The `NSWindow` of the specified window, or `nil` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI id glfwGetCocoaWindow(GLFWwindow* window); + +/*! @brief Returns the `NSView` of the specified window. + * + * @return The `NSView` of the specified window, or `nil` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.4. + * + * @ingroup native + */ +GLFWAPI id glfwGetCocoaView(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_NSGL) +/*! @brief Returns the `NSOpenGLContext` of the specified window. + * + * @return The `NSOpenGLContext` of the specified window, or `nil` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_UNAVAILABLE and @ref GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI id glfwGetNSGLContext(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_X11) +/*! @brief Returns the `Display` used by GLFW. + * + * @return The `Display` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI Display* glfwGetX11Display(void); + +/*! @brief Returns the `RRCrtc` of the specified monitor. + * + * @return The `RRCrtc` of the specified monitor, or `None` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI RRCrtc glfwGetX11Adapter(GLFWmonitor* monitor); + +/*! @brief Returns the `RROutput` of the specified monitor. + * + * @return The `RROutput` of the specified monitor, or `None` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI RROutput glfwGetX11Monitor(GLFWmonitor* monitor); + +/*! @brief Returns the `Window` of the specified window. + * + * @return The `Window` of the specified window, or `None` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI Window glfwGetX11Window(GLFWwindow* window); + +/*! @brief Sets the current primary selection to the specified string. + * + * @param[in] string A UTF-8 encoded string. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwGetX11SelectionString + * @sa glfwSetClipboardString + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI void glfwSetX11SelectionString(const char* string); + +/*! @brief Returns the contents of the current primary selection as a string. + * + * If the selection is empty or if its contents cannot be converted, `NULL` + * is returned and a @ref GLFW_FORMAT_UNAVAILABLE error is generated. + * + * @return The contents of the selection as a UTF-8 encoded string, or `NULL` + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_PLATFORM_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetX11SelectionString or @ref glfwSetX11SelectionString, or until the + * library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwSetX11SelectionString + * @sa glfwGetClipboardString + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetX11SelectionString(void); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_GLX) +/*! @brief Returns the `GLXContext` of the specified window. + * + * @return The `GLXContext` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI GLXContext glfwGetGLXContext(GLFWwindow* window); + +/*! @brief Returns the `GLXWindow` of the specified window. + * + * @return The `GLXWindow` of the specified window, or `None` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI GLXWindow glfwGetGLXWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WAYLAND) +/*! @brief Returns the `struct wl_display*` used by GLFW. + * + * @return The `struct wl_display*` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_display* glfwGetWaylandDisplay(void); + +/*! @brief Returns the `struct wl_output*` of the specified monitor. + * + * @return The `struct wl_output*` of the specified monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_output* glfwGetWaylandMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the main `struct wl_surface*` of the specified window. + * + * @return The main `struct wl_surface*` of the specified window, or `NULL` if + * an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_UNAVAILABLE. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_surface* glfwGetWaylandWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_EGL) +/*! @brief Returns the `EGLDisplay` used by GLFW. + * + * @return The `EGLDisplay` used by GLFW, or `EGL_NO_DISPLAY` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark Because EGL is initialized on demand, this function will return + * `EGL_NO_DISPLAY` until the first context has been created via EGL. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLDisplay glfwGetEGLDisplay(void); + +/*! @brief Returns the `EGLContext` of the specified window. + * + * @return The `EGLContext` of the specified window, or `EGL_NO_CONTEXT` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLContext glfwGetEGLContext(GLFWwindow* window); + +/*! @brief Returns the `EGLSurface` of the specified window. + * + * @return The `EGLSurface` of the specified window, or `EGL_NO_SURFACE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLSurface glfwGetEGLSurface(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_OSMESA) +/*! @brief Retrieves the color buffer associated with the specified window. + * + * @param[in] window The window whose color buffer to retrieve. + * @param[out] width Where to store the width of the color buffer, or `NULL`. + * @param[out] height Where to store the height of the color buffer, or `NULL`. + * @param[out] format Where to store the OSMesa pixel format of the color + * buffer, or `NULL`. + * @param[out] buffer Where to store the address of the color buffer, or + * `NULL`. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI int glfwGetOSMesaColorBuffer(GLFWwindow* window, int* width, int* height, int* format, void** buffer); + +/*! @brief Retrieves the depth buffer associated with the specified window. + * + * @param[in] window The window whose depth buffer to retrieve. + * @param[out] width Where to store the width of the depth buffer, or `NULL`. + * @param[out] height Where to store the height of the depth buffer, or `NULL`. + * @param[out] bytesPerValue Where to store the number of bytes per depth + * buffer element, or `NULL`. + * @param[out] buffer Where to store the address of the depth buffer, or + * `NULL`. + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI int glfwGetOSMesaDepthBuffer(GLFWwindow* window, int* width, int* height, int* bytesPerValue, void** buffer); + +/*! @brief Returns the `OSMesaContext` of the specified window. + * + * @return The `OSMesaContext` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_NO_WINDOW_CONTEXT. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.3. + * + * @ingroup native + */ +GLFWAPI OSMesaContext glfwGetOSMesaContext(GLFWwindow* window); +#endif + +#ifdef __cplusplus +} +#endif + +#endif /* _glfw3_native_h_ */ + diff --git a/TSE_GlfwImpl/src/WindowGlfw.cpp b/TSE_GlfwImpl/src/WindowGlfw.cpp new file mode 100644 index 0000000..82bc35f --- /dev/null +++ b/TSE_GlfwImpl/src/WindowGlfw.cpp @@ -0,0 +1,134 @@ +#include "WindowGlfw.hpp" +#include "Debug.hpp" + +TSE::GLFW::WindowGlfw::WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend) +: WindowGlfw(_title, _width, _height, backend, WindowType::Windowed, 32){ } + +TSE::GLFW::WindowGlfw::WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend, TSE::WindowType type) +: WindowGlfw(_title, _width, _height, backend, type, 32){ } + +TSE::GLFW::WindowGlfw::WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend, TSE::WindowType type, int ppu) +{ + width = _width; + height = _height; + title = _title; + windowType = type; + renderingBackend = backend; + renderingBackend->window = this; + IWindow::lastWindow = this; + if(!Init()) + { + glfwTerminate(); + } +} + +TSE::GLFW::WindowGlfw::~WindowGlfw() +{ + glfwDestroyWindow(window); + glfwTerminate(); +} + +bool TSE::GLFW::WindowGlfw::Init() +{ + if(!BaseInit() || !glfwInit()) + { + Debug::Log("GLFW Error"); + return false; + } + + renderingBackend->InitPreWindow(); + glfwWindowHint(GLFW_FOCUSED, true); + + window = NULL; + + if(windowType == WindowType::Maximized) + { + glfwWindowHint(GLFW_MAXIMIZED, true); + window = glfwCreateWindow(width, height, title.c_str(), NULL, NULL); + int w,h; + glfwGetWindowSize(window, &w, &h); + width = w; + height = h; + } + else if(windowType == WindowType::Fullscreen) + { + auto monitor = glfwGetPrimaryMonitor(); + int w,h; + glfwGetMonitorWorkarea(monitor, nullptr, nullptr, &w, &h); + width = w; + height = h; + window = glfwCreateWindow(width, height, title.c_str(), monitor, NULL); + } + else if(windowType == WindowType::FullscreenWindowed) + { + auto monitor = glfwGetPrimaryMonitor(); + auto mode = glfwGetVideoMode(monitor); + glfwWindowHint(GLFW_RED_BITS, mode->redBits); + glfwWindowHint(GLFW_GREEN_BITS, mode->redBits); + glfwWindowHint(GLFW_BLUE_BITS, mode->redBits); + glfwWindowHint(GLFW_REFRESH_RATE, mode->refreshRate); + width = mode->width; + height = mode->height; + window = glfwCreateWindow(width, height, title.c_str(), monitor, NULL); + } + else + { + window = glfwCreateWindow(width, height, title.c_str(), NULL, NULL); + } + + if(!window) + { + Debug::Log("Failed to create window. Maybe try another WindowType."); + return false; + } + + glfwSetWindowUserPointer(window, this); + + if(!renderingBackend->InitPostWindow()) + { + return false; + } + + //callbacks + glfwSetWindowSizeCallback(window, ResizeWindow); + + Debug::Log("GLFW:" + std::string(glfwGetVersionString())); + + return true; +} + +void TSE::GLFW::WindowGlfw::ResizeWindow(GLFWwindow *wnd, int width, int height) +{ + WindowGlfw* window = (WindowGlfw*)glfwGetWindowUserPointer(wnd); + window->width = width; + window->height = height; + + window->renderingBackend->onResize(width, height); + + for (auto const& i : window->objectsToResize) + { + i->OnResize(width, height, window); + } +} + +void TSE::GLFW::WindowGlfw::Clear() const +{ + renderingBackend->onClear(); +} + +void TSE::GLFW::WindowGlfw::Update() const +{ + glfwPollEvents(); + + renderingBackend->onUpdate(); +} + +void TSE::GLFW::WindowGlfw::ClearDepthBuffer() const +{ + renderingBackend->onClearDepthBuffer(); +} + +bool TSE::GLFW::WindowGlfw::ShouldClose() const +{ + return glfwWindowShouldClose(window); +} diff --git a/TSE_GlfwImpl/src/WindowGlfw.hpp b/TSE_GlfwImpl/src/WindowGlfw.hpp new file mode 100644 index 0000000..0ef0f10 --- /dev/null +++ b/TSE_GlfwImpl/src/WindowGlfw.hpp @@ -0,0 +1,40 @@ +#pragma once + +#include "GLFW/glfw3.h" +#include "Types.hpp" +#include "interfaces/IWindow.hpp" +#include "interfaces/IRenderingBackend.hpp" +#include "enums/WindowType.hpp" +#include "Color.hpp" + + +namespace TSE::GLFW +{ + class WindowGlfw : public IWindow + { + private: + IRenderingBackend* renderingBackend; + + public: + GLFWwindow* window; + WindowType windowType; + bool useImGui = false; + + WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend); + WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend, TSE::WindowType type); + WindowGlfw(string _title, int _width, int _height, IRenderingBackend* backend, TSE::WindowType type, int ppu); + ~WindowGlfw(); + + protected: + bool Init() override; + static void ResizeWindow(GLFWwindow* wnd, int width, int height); + + public: + void Clear() const override; + void Update() const override; + void ClearDepthBuffer() const override; + bool ShouldClose() const override; + inline void Bind() override { }; + inline void Unbind() override { }; + }; +} // namespace TSE::GLFW diff --git a/TSE_GlfwOpenGlImpl/CMakeLists.txt b/TSE_GlfwOpenGlImpl/CMakeLists.txt new file mode 100644 index 0000000..164d50f --- /dev/null +++ b/TSE_GlfwOpenGlImpl/CMakeLists.txt @@ -0,0 +1,60 @@ +#cmake version +cmake_minimum_required(VERSION 3.31) + +#project name +project(TSE_GlfwOpenGlImpl) + +#cpp settings +find_program(CLANG_C NAMES clang) +find_program(CLANG_CXX NAMES clang++) + +if(CLANG_C AND CLANG_CXX) + message(STATUS "foung Clang, using as Compiler") + set(CMAKE_C_COMPILER ${CLANG_C} CACHE STRING "C Compiler" FORCE) + set(CMAKE_CXX_COMPILER ${CLANG_CXX} CACHE STRING "C++ Compiler" FORCE) +else() + message(STATUS "Clang not found, using Standard-Compiler") +endif() +set(CMAKE_CXX_STANDARD 20) +set(CMAKE_CXX_STANDARD_REQUIRED True) + +#project output settings +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY "${PROJECT_SOURCE_DIR}/lib") +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY_DEBUG "${PROJECT_SOURCE_DIR}/lib/Debug") +set(CMAKE_ARCHIVE_OUTPUT_DIRECTORY_RELEASE "${PROJECT_SOURCE_DIR}/lib/Release") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY "${PROJECT_SOURCE_DIR}/lib") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY_DEBUG "${PROJECT_SOURCE_DIR}/lib/Debug") +set(CMAKE_LIBRARY_OUTPUT_DIRECTORY_RELEASE "${PROJECT_SOURCE_DIR}/lib/Release") + +#source files +file(GLOB CPP_SOURCE_TSE + "${PROJECT_SOURCE_DIR}/src/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*/*/*/*.cpp" + "${PROJECT_SOURCE_DIR}/src/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*/*.c" + "${PROJECT_SOURCE_DIR}/src/*/*/*/*.c" +) + +#includes +include_directories(${PROJECT_SOURCE_DIR}/src) +include_directories(${PROJECT_SOURCE_DIR}/include) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Base/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Base/include) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Math/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_Core/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_GlfwImpl/src) +include_directories(${PROJECT_SOURCE_DIR}/../TSE_GlfwImpl/include) + +#project def +if(Lib) + add_library(TSE_GlfwOpenGlImpl SHARED ${CPP_SOURCE_TSE}) +else() + add_library(TSE_GlfwOpenGlImpl STATIC ${CPP_SOURCE_TSE}) +endif() + +#flags +target_compile_options(TSE_GlfwOpenGlImpl PRIVATE -march=native) + diff --git a/TSE_GlfwOpenGlImpl/include/GL/gl3w.h b/TSE_GlfwOpenGlImpl/include/GL/gl3w.h new file mode 100644 index 0000000..25a6a34 --- /dev/null +++ b/TSE_GlfwOpenGlImpl/include/GL/gl3w.h @@ -0,0 +1,1393 @@ +/* + * This file was generated with gl3w_gen.py, part of gl3w + * (hosted at https://github.com/skaslev/gl3w) + * + * This is free and unencumbered software released into the public domain. + * + * Anyone is free to copy, modify, publish, use, compile, sell, or + * distribute this software, either in source code form or as a compiled + * binary, for any purpose, commercial or non-commercial, and by any + * means. + * + * In jurisdictions that recognize copyright laws, the author or authors + * of this software dedicate any and all copyright interest in the + * software to the public domain. We make this dedication for the benefit + * of the public at large and to the detriment of our heirs and + * successors. We intend this dedication to be an overt act of + * relinquishment in perpetuity of all present and future rights to this + * software under copyright law. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR + * OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, + * ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR + * OTHER DEALINGS IN THE SOFTWARE. + */ + +#ifndef __gl3w_h_ +#define __gl3w_h_ + +#include + +#ifndef GL3W_API +#define GL3W_API +#endif + +#ifndef __gl_h_ +#define __gl_h_ +#endif + +#ifdef __cplusplus +extern "C" { +#endif + +#define GL3W_OK 0 +#define GL3W_ERROR_INIT -1 +#define GL3W_ERROR_LIBRARY_OPEN -2 +#define GL3W_ERROR_OPENGL_VERSION -3 + +typedef void (*GL3WglProc)(void); +typedef GL3WglProc (*GL3WGetProcAddressProc)(const char *proc); + +/* gl3w api */ +GL3W_API int gl3wInit(void); +GL3W_API int gl3wInit2(GL3WGetProcAddressProc proc); +GL3W_API int gl3wIsSupported(int major, int minor); +GL3W_API GL3WglProc gl3wGetProcAddress(const char *proc); + +/* gl3w internal state */ +union GL3WProcs { + GL3WglProc ptr[659]; + struct { + PFNGLACTIVESHADERPROGRAMPROC ActiveShaderProgram; + PFNGLACTIVETEXTUREPROC ActiveTexture; + PFNGLATTACHSHADERPROC AttachShader; + PFNGLBEGINCONDITIONALRENDERPROC BeginConditionalRender; + PFNGLBEGINQUERYPROC BeginQuery; + PFNGLBEGINQUERYINDEXEDPROC BeginQueryIndexed; + PFNGLBEGINTRANSFORMFEEDBACKPROC BeginTransformFeedback; + PFNGLBINDATTRIBLOCATIONPROC BindAttribLocation; + PFNGLBINDBUFFERPROC BindBuffer; + PFNGLBINDBUFFERBASEPROC BindBufferBase; + PFNGLBINDBUFFERRANGEPROC BindBufferRange; + PFNGLBINDBUFFERSBASEPROC BindBuffersBase; + PFNGLBINDBUFFERSRANGEPROC BindBuffersRange; + PFNGLBINDFRAGDATALOCATIONPROC BindFragDataLocation; + PFNGLBINDFRAGDATALOCATIONINDEXEDPROC BindFragDataLocationIndexed; + PFNGLBINDFRAMEBUFFERPROC BindFramebuffer; + PFNGLBINDIMAGETEXTUREPROC BindImageTexture; + PFNGLBINDIMAGETEXTURESPROC BindImageTextures; + PFNGLBINDPROGRAMPIPELINEPROC BindProgramPipeline; + PFNGLBINDRENDERBUFFERPROC BindRenderbuffer; + PFNGLBINDSAMPLERPROC BindSampler; + PFNGLBINDSAMPLERSPROC BindSamplers; + PFNGLBINDTEXTUREPROC BindTexture; + PFNGLBINDTEXTUREUNITPROC BindTextureUnit; + PFNGLBINDTEXTURESPROC BindTextures; + PFNGLBINDTRANSFORMFEEDBACKPROC BindTransformFeedback; + PFNGLBINDVERTEXARRAYPROC BindVertexArray; + PFNGLBINDVERTEXBUFFERPROC BindVertexBuffer; + PFNGLBINDVERTEXBUFFERSPROC BindVertexBuffers; + PFNGLBLENDCOLORPROC BlendColor; + PFNGLBLENDEQUATIONPROC BlendEquation; + PFNGLBLENDEQUATIONSEPARATEPROC BlendEquationSeparate; + PFNGLBLENDEQUATIONSEPARATEIPROC BlendEquationSeparatei; + PFNGLBLENDEQUATIONIPROC BlendEquationi; + PFNGLBLENDFUNCPROC BlendFunc; + PFNGLBLENDFUNCSEPARATEPROC BlendFuncSeparate; + PFNGLBLENDFUNCSEPARATEIPROC BlendFuncSeparatei; + PFNGLBLENDFUNCIPROC BlendFunci; + PFNGLBLITFRAMEBUFFERPROC BlitFramebuffer; + PFNGLBLITNAMEDFRAMEBUFFERPROC BlitNamedFramebuffer; + PFNGLBUFFERDATAPROC BufferData; + PFNGLBUFFERSTORAGEPROC BufferStorage; + PFNGLBUFFERSUBDATAPROC BufferSubData; + PFNGLCHECKFRAMEBUFFERSTATUSPROC CheckFramebufferStatus; + PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC CheckNamedFramebufferStatus; + PFNGLCLAMPCOLORPROC ClampColor; + PFNGLCLEARPROC Clear; + PFNGLCLEARBUFFERDATAPROC ClearBufferData; + PFNGLCLEARBUFFERSUBDATAPROC ClearBufferSubData; + PFNGLCLEARBUFFERFIPROC ClearBufferfi; + PFNGLCLEARBUFFERFVPROC ClearBufferfv; + PFNGLCLEARBUFFERIVPROC ClearBufferiv; + PFNGLCLEARBUFFERUIVPROC ClearBufferuiv; + PFNGLCLEARCOLORPROC ClearColor; + PFNGLCLEARDEPTHPROC ClearDepth; + PFNGLCLEARDEPTHFPROC ClearDepthf; + PFNGLCLEARNAMEDBUFFERDATAPROC ClearNamedBufferData; + PFNGLCLEARNAMEDBUFFERSUBDATAPROC ClearNamedBufferSubData; + PFNGLCLEARNAMEDFRAMEBUFFERFIPROC ClearNamedFramebufferfi; + PFNGLCLEARNAMEDFRAMEBUFFERFVPROC ClearNamedFramebufferfv; + PFNGLCLEARNAMEDFRAMEBUFFERIVPROC ClearNamedFramebufferiv; + PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC ClearNamedFramebufferuiv; + PFNGLCLEARSTENCILPROC ClearStencil; + PFNGLCLEARTEXIMAGEPROC ClearTexImage; + PFNGLCLEARTEXSUBIMAGEPROC ClearTexSubImage; + PFNGLCLIENTWAITSYNCPROC ClientWaitSync; + PFNGLCLIPCONTROLPROC ClipControl; + PFNGLCOLORMASKPROC ColorMask; + PFNGLCOLORMASKIPROC ColorMaski; + PFNGLCOMPILESHADERPROC CompileShader; + PFNGLCOMPRESSEDTEXIMAGE1DPROC CompressedTexImage1D; + PFNGLCOMPRESSEDTEXIMAGE2DPROC CompressedTexImage2D; + PFNGLCOMPRESSEDTEXIMAGE3DPROC CompressedTexImage3D; + PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC CompressedTexSubImage1D; + PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC CompressedTexSubImage2D; + PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC CompressedTexSubImage3D; + PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC CompressedTextureSubImage1D; + PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC CompressedTextureSubImage2D; + PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC CompressedTextureSubImage3D; + PFNGLCOPYBUFFERSUBDATAPROC CopyBufferSubData; + PFNGLCOPYIMAGESUBDATAPROC CopyImageSubData; + PFNGLCOPYNAMEDBUFFERSUBDATAPROC CopyNamedBufferSubData; + PFNGLCOPYTEXIMAGE1DPROC CopyTexImage1D; + PFNGLCOPYTEXIMAGE2DPROC CopyTexImage2D; + PFNGLCOPYTEXSUBIMAGE1DPROC CopyTexSubImage1D; + PFNGLCOPYTEXSUBIMAGE2DPROC CopyTexSubImage2D; + PFNGLCOPYTEXSUBIMAGE3DPROC CopyTexSubImage3D; + PFNGLCOPYTEXTURESUBIMAGE1DPROC CopyTextureSubImage1D; + PFNGLCOPYTEXTURESUBIMAGE2DPROC CopyTextureSubImage2D; + PFNGLCOPYTEXTURESUBIMAGE3DPROC CopyTextureSubImage3D; + PFNGLCREATEBUFFERSPROC CreateBuffers; + PFNGLCREATEFRAMEBUFFERSPROC CreateFramebuffers; + PFNGLCREATEPROGRAMPROC CreateProgram; + PFNGLCREATEPROGRAMPIPELINESPROC CreateProgramPipelines; + PFNGLCREATEQUERIESPROC CreateQueries; + PFNGLCREATERENDERBUFFERSPROC CreateRenderbuffers; + PFNGLCREATESAMPLERSPROC CreateSamplers; + PFNGLCREATESHADERPROC CreateShader; + PFNGLCREATESHADERPROGRAMVPROC CreateShaderProgramv; + PFNGLCREATETEXTURESPROC CreateTextures; + PFNGLCREATETRANSFORMFEEDBACKSPROC CreateTransformFeedbacks; + PFNGLCREATEVERTEXARRAYSPROC CreateVertexArrays; + PFNGLCULLFACEPROC CullFace; + PFNGLDEBUGMESSAGECALLBACKPROC DebugMessageCallback; + PFNGLDEBUGMESSAGECONTROLPROC DebugMessageControl; + PFNGLDEBUGMESSAGEINSERTPROC DebugMessageInsert; + PFNGLDELETEBUFFERSPROC DeleteBuffers; + PFNGLDELETEFRAMEBUFFERSPROC DeleteFramebuffers; + PFNGLDELETEPROGRAMPROC DeleteProgram; + PFNGLDELETEPROGRAMPIPELINESPROC DeleteProgramPipelines; + PFNGLDELETEQUERIESPROC DeleteQueries; + PFNGLDELETERENDERBUFFERSPROC DeleteRenderbuffers; + PFNGLDELETESAMPLERSPROC DeleteSamplers; + PFNGLDELETESHADERPROC DeleteShader; + PFNGLDELETESYNCPROC DeleteSync; + PFNGLDELETETEXTURESPROC DeleteTextures; + PFNGLDELETETRANSFORMFEEDBACKSPROC DeleteTransformFeedbacks; + PFNGLDELETEVERTEXARRAYSPROC DeleteVertexArrays; + PFNGLDEPTHFUNCPROC DepthFunc; + PFNGLDEPTHMASKPROC DepthMask; + PFNGLDEPTHRANGEPROC DepthRange; + PFNGLDEPTHRANGEARRAYVPROC DepthRangeArrayv; + PFNGLDEPTHRANGEINDEXEDPROC DepthRangeIndexed; + PFNGLDEPTHRANGEFPROC DepthRangef; + PFNGLDETACHSHADERPROC DetachShader; + PFNGLDISABLEPROC Disable; + PFNGLDISABLEVERTEXARRAYATTRIBPROC DisableVertexArrayAttrib; + PFNGLDISABLEVERTEXATTRIBARRAYPROC DisableVertexAttribArray; + PFNGLDISABLEIPROC Disablei; + PFNGLDISPATCHCOMPUTEPROC DispatchCompute; + PFNGLDISPATCHCOMPUTEINDIRECTPROC DispatchComputeIndirect; + PFNGLDRAWARRAYSPROC DrawArrays; + PFNGLDRAWARRAYSINDIRECTPROC DrawArraysIndirect; + PFNGLDRAWARRAYSINSTANCEDPROC DrawArraysInstanced; + PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC DrawArraysInstancedBaseInstance; + PFNGLDRAWBUFFERPROC DrawBuffer; + PFNGLDRAWBUFFERSPROC DrawBuffers; + PFNGLDRAWELEMENTSPROC DrawElements; + PFNGLDRAWELEMENTSBASEVERTEXPROC DrawElementsBaseVertex; + PFNGLDRAWELEMENTSINDIRECTPROC DrawElementsIndirect; + PFNGLDRAWELEMENTSINSTANCEDPROC DrawElementsInstanced; + PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC DrawElementsInstancedBaseInstance; + PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC DrawElementsInstancedBaseVertex; + PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC DrawElementsInstancedBaseVertexBaseInstance; + PFNGLDRAWRANGEELEMENTSPROC DrawRangeElements; + PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC DrawRangeElementsBaseVertex; + PFNGLDRAWTRANSFORMFEEDBACKPROC DrawTransformFeedback; + PFNGLDRAWTRANSFORMFEEDBACKINSTANCEDPROC DrawTransformFeedbackInstanced; + PFNGLDRAWTRANSFORMFEEDBACKSTREAMPROC DrawTransformFeedbackStream; + PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC DrawTransformFeedbackStreamInstanced; + PFNGLENABLEPROC Enable; + PFNGLENABLEVERTEXARRAYATTRIBPROC EnableVertexArrayAttrib; + PFNGLENABLEVERTEXATTRIBARRAYPROC EnableVertexAttribArray; + PFNGLENABLEIPROC Enablei; + PFNGLENDCONDITIONALRENDERPROC EndConditionalRender; + PFNGLENDQUERYPROC EndQuery; + PFNGLENDQUERYINDEXEDPROC EndQueryIndexed; + PFNGLENDTRANSFORMFEEDBACKPROC EndTransformFeedback; + PFNGLFENCESYNCPROC FenceSync; + PFNGLFINISHPROC Finish; + PFNGLFLUSHPROC Flush; + PFNGLFLUSHMAPPEDBUFFERRANGEPROC FlushMappedBufferRange; + PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC FlushMappedNamedBufferRange; + PFNGLFRAMEBUFFERPARAMETERIPROC FramebufferParameteri; + PFNGLFRAMEBUFFERPARAMETERIMESAPROC FramebufferParameteriMESA; + PFNGLFRAMEBUFFERRENDERBUFFERPROC FramebufferRenderbuffer; + PFNGLFRAMEBUFFERTEXTUREPROC FramebufferTexture; + PFNGLFRAMEBUFFERTEXTURE1DPROC FramebufferTexture1D; + PFNGLFRAMEBUFFERTEXTURE2DPROC FramebufferTexture2D; + PFNGLFRAMEBUFFERTEXTURE3DPROC FramebufferTexture3D; + PFNGLFRAMEBUFFERTEXTURELAYERPROC FramebufferTextureLayer; + PFNGLFRONTFACEPROC FrontFace; + PFNGLGENBUFFERSPROC GenBuffers; + PFNGLGENFRAMEBUFFERSPROC GenFramebuffers; + PFNGLGENPROGRAMPIPELINESPROC GenProgramPipelines; + PFNGLGENQUERIESPROC GenQueries; + PFNGLGENRENDERBUFFERSPROC GenRenderbuffers; + PFNGLGENSAMPLERSPROC GenSamplers; + PFNGLGENTEXTURESPROC GenTextures; + PFNGLGENTRANSFORMFEEDBACKSPROC GenTransformFeedbacks; + PFNGLGENVERTEXARRAYSPROC GenVertexArrays; + PFNGLGENERATEMIPMAPPROC GenerateMipmap; + PFNGLGENERATETEXTUREMIPMAPPROC GenerateTextureMipmap; + PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC GetActiveAtomicCounterBufferiv; + PFNGLGETACTIVEATTRIBPROC GetActiveAttrib; + PFNGLGETACTIVESUBROUTINENAMEPROC GetActiveSubroutineName; + PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC GetActiveSubroutineUniformName; + PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC GetActiveSubroutineUniformiv; + PFNGLGETACTIVEUNIFORMPROC GetActiveUniform; + PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC GetActiveUniformBlockName; + PFNGLGETACTIVEUNIFORMBLOCKIVPROC GetActiveUniformBlockiv; + PFNGLGETACTIVEUNIFORMNAMEPROC GetActiveUniformName; + PFNGLGETACTIVEUNIFORMSIVPROC GetActiveUniformsiv; + PFNGLGETATTACHEDSHADERSPROC GetAttachedShaders; + PFNGLGETATTRIBLOCATIONPROC GetAttribLocation; + PFNGLGETBOOLEANI_VPROC GetBooleani_v; + PFNGLGETBOOLEANVPROC GetBooleanv; + PFNGLGETBUFFERPARAMETERI64VPROC GetBufferParameteri64v; + PFNGLGETBUFFERPARAMETERIVPROC GetBufferParameteriv; + PFNGLGETBUFFERPOINTERVPROC GetBufferPointerv; + PFNGLGETBUFFERSUBDATAPROC GetBufferSubData; + PFNGLGETCOMPRESSEDTEXIMAGEPROC GetCompressedTexImage; + PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC GetCompressedTextureImage; + PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC GetCompressedTextureSubImage; + PFNGLGETDEBUGMESSAGELOGPROC GetDebugMessageLog; + PFNGLGETDOUBLEI_VPROC GetDoublei_v; + PFNGLGETDOUBLEVPROC GetDoublev; + PFNGLGETERRORPROC GetError; + PFNGLGETFLOATI_VPROC GetFloati_v; + PFNGLGETFLOATVPROC GetFloatv; + PFNGLGETFRAGDATAINDEXPROC GetFragDataIndex; + PFNGLGETFRAGDATALOCATIONPROC GetFragDataLocation; + PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC GetFramebufferAttachmentParameteriv; + PFNGLGETFRAMEBUFFERPARAMETERIVPROC GetFramebufferParameteriv; + PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC GetFramebufferParameterivMESA; + PFNGLGETGRAPHICSRESETSTATUSPROC GetGraphicsResetStatus; + PFNGLGETINTEGER64I_VPROC GetInteger64i_v; + PFNGLGETINTEGER64VPROC GetInteger64v; + PFNGLGETINTEGERI_VPROC GetIntegeri_v; + PFNGLGETINTEGERVPROC GetIntegerv; + PFNGLGETINTERNALFORMATI64VPROC GetInternalformati64v; + PFNGLGETINTERNALFORMATIVPROC GetInternalformativ; + PFNGLGETMULTISAMPLEFVPROC GetMultisamplefv; + PFNGLGETNAMEDBUFFERPARAMETERI64VPROC GetNamedBufferParameteri64v; + PFNGLGETNAMEDBUFFERPARAMETERIVPROC GetNamedBufferParameteriv; + PFNGLGETNAMEDBUFFERPOINTERVPROC GetNamedBufferPointerv; + PFNGLGETNAMEDBUFFERSUBDATAPROC GetNamedBufferSubData; + PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC GetNamedFramebufferAttachmentParameteriv; + PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC GetNamedFramebufferParameteriv; + PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC GetNamedRenderbufferParameteriv; + PFNGLGETOBJECTLABELPROC GetObjectLabel; + PFNGLGETOBJECTPTRLABELPROC GetObjectPtrLabel; + PFNGLGETPOINTERVPROC GetPointerv; + PFNGLGETPROGRAMBINARYPROC GetProgramBinary; + PFNGLGETPROGRAMINFOLOGPROC GetProgramInfoLog; + PFNGLGETPROGRAMINTERFACEIVPROC GetProgramInterfaceiv; + PFNGLGETPROGRAMPIPELINEINFOLOGPROC GetProgramPipelineInfoLog; + PFNGLGETPROGRAMPIPELINEIVPROC GetProgramPipelineiv; + PFNGLGETPROGRAMRESOURCEINDEXPROC GetProgramResourceIndex; + PFNGLGETPROGRAMRESOURCELOCATIONPROC GetProgramResourceLocation; + PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC GetProgramResourceLocationIndex; + PFNGLGETPROGRAMRESOURCENAMEPROC GetProgramResourceName; + PFNGLGETPROGRAMRESOURCEIVPROC GetProgramResourceiv; + PFNGLGETPROGRAMSTAGEIVPROC GetProgramStageiv; + PFNGLGETPROGRAMIVPROC GetProgramiv; + PFNGLGETQUERYBUFFEROBJECTI64VPROC GetQueryBufferObjecti64v; + PFNGLGETQUERYBUFFEROBJECTIVPROC GetQueryBufferObjectiv; + PFNGLGETQUERYBUFFEROBJECTUI64VPROC GetQueryBufferObjectui64v; + PFNGLGETQUERYBUFFEROBJECTUIVPROC GetQueryBufferObjectuiv; + PFNGLGETQUERYINDEXEDIVPROC GetQueryIndexediv; + PFNGLGETQUERYOBJECTI64VPROC GetQueryObjecti64v; + PFNGLGETQUERYOBJECTIVPROC GetQueryObjectiv; + PFNGLGETQUERYOBJECTUI64VPROC GetQueryObjectui64v; + PFNGLGETQUERYOBJECTUIVPROC GetQueryObjectuiv; + PFNGLGETQUERYIVPROC GetQueryiv; + PFNGLGETRENDERBUFFERPARAMETERIVPROC GetRenderbufferParameteriv; + PFNGLGETSAMPLERPARAMETERIIVPROC GetSamplerParameterIiv; + PFNGLGETSAMPLERPARAMETERIUIVPROC GetSamplerParameterIuiv; + PFNGLGETSAMPLERPARAMETERFVPROC GetSamplerParameterfv; + PFNGLGETSAMPLERPARAMETERIVPROC GetSamplerParameteriv; + PFNGLGETSHADERINFOLOGPROC GetShaderInfoLog; + PFNGLGETSHADERPRECISIONFORMATPROC GetShaderPrecisionFormat; + PFNGLGETSHADERSOURCEPROC GetShaderSource; + PFNGLGETSHADERIVPROC GetShaderiv; + PFNGLGETSTRINGPROC GetString; + PFNGLGETSTRINGIPROC GetStringi; + PFNGLGETSUBROUTINEINDEXPROC GetSubroutineIndex; + PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC GetSubroutineUniformLocation; + PFNGLGETSYNCIVPROC GetSynciv; + PFNGLGETTEXIMAGEPROC GetTexImage; + PFNGLGETTEXLEVELPARAMETERFVPROC GetTexLevelParameterfv; + PFNGLGETTEXLEVELPARAMETERIVPROC GetTexLevelParameteriv; + PFNGLGETTEXPARAMETERIIVPROC GetTexParameterIiv; + PFNGLGETTEXPARAMETERIUIVPROC GetTexParameterIuiv; + PFNGLGETTEXPARAMETERFVPROC GetTexParameterfv; + PFNGLGETTEXPARAMETERIVPROC GetTexParameteriv; + PFNGLGETTEXTUREIMAGEPROC GetTextureImage; + PFNGLGETTEXTURELEVELPARAMETERFVPROC GetTextureLevelParameterfv; + PFNGLGETTEXTURELEVELPARAMETERIVPROC GetTextureLevelParameteriv; + PFNGLGETTEXTUREPARAMETERIIVPROC GetTextureParameterIiv; + PFNGLGETTEXTUREPARAMETERIUIVPROC GetTextureParameterIuiv; + PFNGLGETTEXTUREPARAMETERFVPROC GetTextureParameterfv; + PFNGLGETTEXTUREPARAMETERIVPROC GetTextureParameteriv; + PFNGLGETTEXTURESUBIMAGEPROC GetTextureSubImage; + PFNGLGETTRANSFORMFEEDBACKVARYINGPROC GetTransformFeedbackVarying; + PFNGLGETTRANSFORMFEEDBACKI64_VPROC GetTransformFeedbacki64_v; + PFNGLGETTRANSFORMFEEDBACKI_VPROC GetTransformFeedbacki_v; + PFNGLGETTRANSFORMFEEDBACKIVPROC GetTransformFeedbackiv; + PFNGLGETUNIFORMBLOCKINDEXPROC GetUniformBlockIndex; + PFNGLGETUNIFORMINDICESPROC GetUniformIndices; + PFNGLGETUNIFORMLOCATIONPROC GetUniformLocation; + PFNGLGETUNIFORMSUBROUTINEUIVPROC GetUniformSubroutineuiv; + PFNGLGETUNIFORMDVPROC GetUniformdv; + PFNGLGETUNIFORMFVPROC GetUniformfv; + PFNGLGETUNIFORMIVPROC GetUniformiv; + PFNGLGETUNIFORMUIVPROC GetUniformuiv; + PFNGLGETVERTEXARRAYINDEXED64IVPROC GetVertexArrayIndexed64iv; + PFNGLGETVERTEXARRAYINDEXEDIVPROC GetVertexArrayIndexediv; + PFNGLGETVERTEXARRAYIVPROC GetVertexArrayiv; + PFNGLGETVERTEXATTRIBIIVPROC GetVertexAttribIiv; + PFNGLGETVERTEXATTRIBIUIVPROC GetVertexAttribIuiv; + PFNGLGETVERTEXATTRIBLDVPROC GetVertexAttribLdv; + PFNGLGETVERTEXATTRIBPOINTERVPROC GetVertexAttribPointerv; + PFNGLGETVERTEXATTRIBDVPROC GetVertexAttribdv; + PFNGLGETVERTEXATTRIBFVPROC GetVertexAttribfv; + PFNGLGETVERTEXATTRIBIVPROC GetVertexAttribiv; + PFNGLGETNCOMPRESSEDTEXIMAGEPROC GetnCompressedTexImage; + PFNGLGETNTEXIMAGEPROC GetnTexImage; + PFNGLGETNUNIFORMDVPROC GetnUniformdv; + PFNGLGETNUNIFORMFVPROC GetnUniformfv; + PFNGLGETNUNIFORMIVPROC GetnUniformiv; + PFNGLGETNUNIFORMUIVPROC GetnUniformuiv; + PFNGLHINTPROC Hint; + PFNGLINVALIDATEBUFFERDATAPROC InvalidateBufferData; + PFNGLINVALIDATEBUFFERSUBDATAPROC InvalidateBufferSubData; + PFNGLINVALIDATEFRAMEBUFFERPROC InvalidateFramebuffer; + PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC InvalidateNamedFramebufferData; + PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC InvalidateNamedFramebufferSubData; + PFNGLINVALIDATESUBFRAMEBUFFERPROC InvalidateSubFramebuffer; + PFNGLINVALIDATETEXIMAGEPROC InvalidateTexImage; + PFNGLINVALIDATETEXSUBIMAGEPROC InvalidateTexSubImage; + PFNGLISBUFFERPROC IsBuffer; + PFNGLISENABLEDPROC IsEnabled; + PFNGLISENABLEDIPROC IsEnabledi; + PFNGLISFRAMEBUFFERPROC IsFramebuffer; + PFNGLISPROGRAMPROC IsProgram; + PFNGLISPROGRAMPIPELINEPROC IsProgramPipeline; + PFNGLISQUERYPROC IsQuery; + PFNGLISRENDERBUFFERPROC IsRenderbuffer; + PFNGLISSAMPLERPROC IsSampler; + PFNGLISSHADERPROC IsShader; + PFNGLISSYNCPROC IsSync; + PFNGLISTEXTUREPROC IsTexture; + PFNGLISTRANSFORMFEEDBACKPROC IsTransformFeedback; + PFNGLISVERTEXARRAYPROC IsVertexArray; + PFNGLLINEWIDTHPROC LineWidth; + PFNGLLINKPROGRAMPROC LinkProgram; + PFNGLLOGICOPPROC LogicOp; + PFNGLMAPBUFFERPROC MapBuffer; + PFNGLMAPBUFFERRANGEPROC MapBufferRange; + PFNGLMAPNAMEDBUFFERPROC MapNamedBuffer; + PFNGLMAPNAMEDBUFFERRANGEPROC MapNamedBufferRange; + PFNGLMEMORYBARRIERPROC MemoryBarrier; + PFNGLMEMORYBARRIERBYREGIONPROC MemoryBarrierByRegion; + PFNGLMINSAMPLESHADINGPROC MinSampleShading; + PFNGLMULTIDRAWARRAYSPROC MultiDrawArrays; + PFNGLMULTIDRAWARRAYSINDIRECTPROC MultiDrawArraysIndirect; + PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC MultiDrawArraysIndirectCount; + PFNGLMULTIDRAWELEMENTSPROC MultiDrawElements; + PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC MultiDrawElementsBaseVertex; + PFNGLMULTIDRAWELEMENTSINDIRECTPROC MultiDrawElementsIndirect; + PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC MultiDrawElementsIndirectCount; + PFNGLNAMEDBUFFERDATAPROC NamedBufferData; + PFNGLNAMEDBUFFERSTORAGEPROC NamedBufferStorage; + PFNGLNAMEDBUFFERSUBDATAPROC NamedBufferSubData; + PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC NamedFramebufferDrawBuffer; + PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC NamedFramebufferDrawBuffers; + PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC NamedFramebufferParameteri; + PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC NamedFramebufferReadBuffer; + PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC NamedFramebufferRenderbuffer; + PFNGLNAMEDFRAMEBUFFERTEXTUREPROC NamedFramebufferTexture; + PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC NamedFramebufferTextureLayer; + PFNGLNAMEDRENDERBUFFERSTORAGEPROC NamedRenderbufferStorage; + PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC NamedRenderbufferStorageMultisample; + PFNGLOBJECTLABELPROC ObjectLabel; + PFNGLOBJECTPTRLABELPROC ObjectPtrLabel; + PFNGLPATCHPARAMETERFVPROC PatchParameterfv; + PFNGLPATCHPARAMETERIPROC PatchParameteri; + PFNGLPAUSETRANSFORMFEEDBACKPROC PauseTransformFeedback; + PFNGLPIXELSTOREFPROC PixelStoref; + PFNGLPIXELSTOREIPROC PixelStorei; + PFNGLPOINTPARAMETERFPROC PointParameterf; + PFNGLPOINTPARAMETERFVPROC PointParameterfv; + PFNGLPOINTPARAMETERIPROC PointParameteri; + PFNGLPOINTPARAMETERIVPROC PointParameteriv; + PFNGLPOINTSIZEPROC PointSize; + PFNGLPOLYGONMODEPROC PolygonMode; + PFNGLPOLYGONOFFSETPROC PolygonOffset; + PFNGLPOLYGONOFFSETCLAMPPROC PolygonOffsetClamp; + PFNGLPOPDEBUGGROUPPROC PopDebugGroup; + PFNGLPRIMITIVERESTARTINDEXPROC PrimitiveRestartIndex; + PFNGLPROGRAMBINARYPROC ProgramBinary; + PFNGLPROGRAMPARAMETERIPROC ProgramParameteri; + PFNGLPROGRAMUNIFORM1DPROC ProgramUniform1d; + PFNGLPROGRAMUNIFORM1DVPROC ProgramUniform1dv; + PFNGLPROGRAMUNIFORM1FPROC ProgramUniform1f; + PFNGLPROGRAMUNIFORM1FVPROC ProgramUniform1fv; + PFNGLPROGRAMUNIFORM1IPROC ProgramUniform1i; + PFNGLPROGRAMUNIFORM1IVPROC ProgramUniform1iv; + PFNGLPROGRAMUNIFORM1UIPROC ProgramUniform1ui; + PFNGLPROGRAMUNIFORM1UIVPROC ProgramUniform1uiv; + PFNGLPROGRAMUNIFORM2DPROC ProgramUniform2d; + PFNGLPROGRAMUNIFORM2DVPROC ProgramUniform2dv; + PFNGLPROGRAMUNIFORM2FPROC ProgramUniform2f; + PFNGLPROGRAMUNIFORM2FVPROC ProgramUniform2fv; + PFNGLPROGRAMUNIFORM2IPROC ProgramUniform2i; + PFNGLPROGRAMUNIFORM2IVPROC ProgramUniform2iv; + PFNGLPROGRAMUNIFORM2UIPROC ProgramUniform2ui; + PFNGLPROGRAMUNIFORM2UIVPROC ProgramUniform2uiv; + PFNGLPROGRAMUNIFORM3DPROC ProgramUniform3d; + PFNGLPROGRAMUNIFORM3DVPROC ProgramUniform3dv; + PFNGLPROGRAMUNIFORM3FPROC ProgramUniform3f; + PFNGLPROGRAMUNIFORM3FVPROC ProgramUniform3fv; + PFNGLPROGRAMUNIFORM3IPROC ProgramUniform3i; + PFNGLPROGRAMUNIFORM3IVPROC ProgramUniform3iv; + PFNGLPROGRAMUNIFORM3UIPROC ProgramUniform3ui; + PFNGLPROGRAMUNIFORM3UIVPROC ProgramUniform3uiv; + PFNGLPROGRAMUNIFORM4DPROC ProgramUniform4d; + PFNGLPROGRAMUNIFORM4DVPROC ProgramUniform4dv; + PFNGLPROGRAMUNIFORM4FPROC ProgramUniform4f; + PFNGLPROGRAMUNIFORM4FVPROC ProgramUniform4fv; + PFNGLPROGRAMUNIFORM4IPROC ProgramUniform4i; + PFNGLPROGRAMUNIFORM4IVPROC ProgramUniform4iv; + PFNGLPROGRAMUNIFORM4UIPROC ProgramUniform4ui; + PFNGLPROGRAMUNIFORM4UIVPROC ProgramUniform4uiv; + PFNGLPROGRAMUNIFORMMATRIX2DVPROC ProgramUniformMatrix2dv; + PFNGLPROGRAMUNIFORMMATRIX2FVPROC ProgramUniformMatrix2fv; + PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC ProgramUniformMatrix2x3dv; + PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC ProgramUniformMatrix2x3fv; + PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC ProgramUniformMatrix2x4dv; + PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC ProgramUniformMatrix2x4fv; + PFNGLPROGRAMUNIFORMMATRIX3DVPROC ProgramUniformMatrix3dv; + PFNGLPROGRAMUNIFORMMATRIX3FVPROC ProgramUniformMatrix3fv; + PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC ProgramUniformMatrix3x2dv; + PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC ProgramUniformMatrix3x2fv; + PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC ProgramUniformMatrix3x4dv; + PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC ProgramUniformMatrix3x4fv; + PFNGLPROGRAMUNIFORMMATRIX4DVPROC ProgramUniformMatrix4dv; + PFNGLPROGRAMUNIFORMMATRIX4FVPROC ProgramUniformMatrix4fv; + PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC ProgramUniformMatrix4x2dv; + PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC ProgramUniformMatrix4x2fv; + PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC ProgramUniformMatrix4x3dv; + PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC ProgramUniformMatrix4x3fv; + PFNGLPROVOKINGVERTEXPROC ProvokingVertex; + PFNGLPUSHDEBUGGROUPPROC PushDebugGroup; + PFNGLQUERYCOUNTERPROC QueryCounter; + PFNGLREADBUFFERPROC ReadBuffer; + PFNGLREADPIXELSPROC ReadPixels; + PFNGLREADNPIXELSPROC ReadnPixels; + PFNGLRELEASESHADERCOMPILERPROC ReleaseShaderCompiler; + PFNGLRENDERBUFFERSTORAGEPROC RenderbufferStorage; + PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC RenderbufferStorageMultisample; + PFNGLRESUMETRANSFORMFEEDBACKPROC ResumeTransformFeedback; + PFNGLSAMPLECOVERAGEPROC SampleCoverage; + PFNGLSAMPLEMASKIPROC SampleMaski; + PFNGLSAMPLERPARAMETERIIVPROC SamplerParameterIiv; + PFNGLSAMPLERPARAMETERIUIVPROC SamplerParameterIuiv; + PFNGLSAMPLERPARAMETERFPROC SamplerParameterf; + PFNGLSAMPLERPARAMETERFVPROC SamplerParameterfv; + PFNGLSAMPLERPARAMETERIPROC SamplerParameteri; + PFNGLSAMPLERPARAMETERIVPROC SamplerParameteriv; + PFNGLSCISSORPROC Scissor; + PFNGLSCISSORARRAYVPROC ScissorArrayv; + PFNGLSCISSORINDEXEDPROC ScissorIndexed; + PFNGLSCISSORINDEXEDVPROC ScissorIndexedv; + PFNGLSHADERBINARYPROC ShaderBinary; + PFNGLSHADERSOURCEPROC ShaderSource; + PFNGLSHADERSTORAGEBLOCKBINDINGPROC ShaderStorageBlockBinding; + PFNGLSPECIALIZESHADERPROC SpecializeShader; + PFNGLSTENCILFUNCPROC StencilFunc; + PFNGLSTENCILFUNCSEPARATEPROC StencilFuncSeparate; + PFNGLSTENCILMASKPROC StencilMask; + PFNGLSTENCILMASKSEPARATEPROC StencilMaskSeparate; + PFNGLSTENCILOPPROC StencilOp; + PFNGLSTENCILOPSEPARATEPROC StencilOpSeparate; + PFNGLTEXBUFFERPROC TexBuffer; + PFNGLTEXBUFFERRANGEPROC TexBufferRange; + PFNGLTEXIMAGE1DPROC TexImage1D; + PFNGLTEXIMAGE2DPROC TexImage2D; + PFNGLTEXIMAGE2DMULTISAMPLEPROC TexImage2DMultisample; + PFNGLTEXIMAGE3DPROC TexImage3D; + PFNGLTEXIMAGE3DMULTISAMPLEPROC TexImage3DMultisample; + PFNGLTEXPARAMETERIIVPROC TexParameterIiv; + PFNGLTEXPARAMETERIUIVPROC TexParameterIuiv; + PFNGLTEXPARAMETERFPROC TexParameterf; + PFNGLTEXPARAMETERFVPROC TexParameterfv; + PFNGLTEXPARAMETERIPROC TexParameteri; + PFNGLTEXPARAMETERIVPROC TexParameteriv; + PFNGLTEXSTORAGE1DPROC TexStorage1D; + PFNGLTEXSTORAGE2DPROC TexStorage2D; + PFNGLTEXSTORAGE2DMULTISAMPLEPROC TexStorage2DMultisample; + PFNGLTEXSTORAGE3DPROC TexStorage3D; + PFNGLTEXSTORAGE3DMULTISAMPLEPROC TexStorage3DMultisample; + PFNGLTEXSUBIMAGE1DPROC TexSubImage1D; + PFNGLTEXSUBIMAGE2DPROC TexSubImage2D; + PFNGLTEXSUBIMAGE3DPROC TexSubImage3D; + PFNGLTEXTUREBARRIERPROC TextureBarrier; + PFNGLTEXTUREBUFFERPROC TextureBuffer; + PFNGLTEXTUREBUFFERRANGEPROC TextureBufferRange; + PFNGLTEXTUREPARAMETERIIVPROC TextureParameterIiv; + PFNGLTEXTUREPARAMETERIUIVPROC TextureParameterIuiv; + PFNGLTEXTUREPARAMETERFPROC TextureParameterf; + PFNGLTEXTUREPARAMETERFVPROC TextureParameterfv; + PFNGLTEXTUREPARAMETERIPROC TextureParameteri; + PFNGLTEXTUREPARAMETERIVPROC TextureParameteriv; + PFNGLTEXTURESTORAGE1DPROC TextureStorage1D; + PFNGLTEXTURESTORAGE2DPROC TextureStorage2D; + PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC TextureStorage2DMultisample; + PFNGLTEXTURESTORAGE3DPROC TextureStorage3D; + PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC TextureStorage3DMultisample; + PFNGLTEXTURESUBIMAGE1DPROC TextureSubImage1D; + PFNGLTEXTURESUBIMAGE2DPROC TextureSubImage2D; + PFNGLTEXTURESUBIMAGE3DPROC TextureSubImage3D; + PFNGLTEXTUREVIEWPROC TextureView; + PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC TransformFeedbackBufferBase; + PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC TransformFeedbackBufferRange; + PFNGLTRANSFORMFEEDBACKVARYINGSPROC TransformFeedbackVaryings; + PFNGLUNIFORM1DPROC Uniform1d; + PFNGLUNIFORM1DVPROC Uniform1dv; + PFNGLUNIFORM1FPROC Uniform1f; + PFNGLUNIFORM1FVPROC Uniform1fv; + PFNGLUNIFORM1IPROC Uniform1i; + PFNGLUNIFORM1IVPROC Uniform1iv; + PFNGLUNIFORM1UIPROC Uniform1ui; + PFNGLUNIFORM1UIVPROC Uniform1uiv; + PFNGLUNIFORM2DPROC Uniform2d; + PFNGLUNIFORM2DVPROC Uniform2dv; + PFNGLUNIFORM2FPROC Uniform2f; + PFNGLUNIFORM2FVPROC Uniform2fv; + PFNGLUNIFORM2IPROC Uniform2i; + PFNGLUNIFORM2IVPROC Uniform2iv; + PFNGLUNIFORM2UIPROC Uniform2ui; + PFNGLUNIFORM2UIVPROC Uniform2uiv; + PFNGLUNIFORM3DPROC Uniform3d; + PFNGLUNIFORM3DVPROC Uniform3dv; + PFNGLUNIFORM3FPROC Uniform3f; + PFNGLUNIFORM3FVPROC Uniform3fv; + PFNGLUNIFORM3IPROC Uniform3i; + PFNGLUNIFORM3IVPROC Uniform3iv; + PFNGLUNIFORM3UIPROC Uniform3ui; + PFNGLUNIFORM3UIVPROC Uniform3uiv; + PFNGLUNIFORM4DPROC Uniform4d; + PFNGLUNIFORM4DVPROC Uniform4dv; + PFNGLUNIFORM4FPROC Uniform4f; + PFNGLUNIFORM4FVPROC Uniform4fv; + PFNGLUNIFORM4IPROC Uniform4i; + PFNGLUNIFORM4IVPROC Uniform4iv; + PFNGLUNIFORM4UIPROC Uniform4ui; + PFNGLUNIFORM4UIVPROC Uniform4uiv; + PFNGLUNIFORMBLOCKBINDINGPROC UniformBlockBinding; + PFNGLUNIFORMMATRIX2DVPROC UniformMatrix2dv; + PFNGLUNIFORMMATRIX2FVPROC UniformMatrix2fv; + PFNGLUNIFORMMATRIX2X3DVPROC UniformMatrix2x3dv; + PFNGLUNIFORMMATRIX2X3FVPROC UniformMatrix2x3fv; + PFNGLUNIFORMMATRIX2X4DVPROC UniformMatrix2x4dv; + PFNGLUNIFORMMATRIX2X4FVPROC UniformMatrix2x4fv; + PFNGLUNIFORMMATRIX3DVPROC UniformMatrix3dv; + PFNGLUNIFORMMATRIX3FVPROC UniformMatrix3fv; + PFNGLUNIFORMMATRIX3X2DVPROC UniformMatrix3x2dv; + PFNGLUNIFORMMATRIX3X2FVPROC UniformMatrix3x2fv; + PFNGLUNIFORMMATRIX3X4DVPROC UniformMatrix3x4dv; + PFNGLUNIFORMMATRIX3X4FVPROC UniformMatrix3x4fv; + PFNGLUNIFORMMATRIX4DVPROC UniformMatrix4dv; + PFNGLUNIFORMMATRIX4FVPROC UniformMatrix4fv; + PFNGLUNIFORMMATRIX4X2DVPROC UniformMatrix4x2dv; + PFNGLUNIFORMMATRIX4X2FVPROC UniformMatrix4x2fv; + PFNGLUNIFORMMATRIX4X3DVPROC UniformMatrix4x3dv; + PFNGLUNIFORMMATRIX4X3FVPROC UniformMatrix4x3fv; + PFNGLUNIFORMSUBROUTINESUIVPROC UniformSubroutinesuiv; + PFNGLUNMAPBUFFERPROC UnmapBuffer; + PFNGLUNMAPNAMEDBUFFERPROC UnmapNamedBuffer; + PFNGLUSEPROGRAMPROC UseProgram; + PFNGLUSEPROGRAMSTAGESPROC UseProgramStages; + PFNGLVALIDATEPROGRAMPROC ValidateProgram; + PFNGLVALIDATEPROGRAMPIPELINEPROC ValidateProgramPipeline; + PFNGLVERTEXARRAYATTRIBBINDINGPROC VertexArrayAttribBinding; + PFNGLVERTEXARRAYATTRIBFORMATPROC VertexArrayAttribFormat; + PFNGLVERTEXARRAYATTRIBIFORMATPROC VertexArrayAttribIFormat; + PFNGLVERTEXARRAYATTRIBLFORMATPROC VertexArrayAttribLFormat; + PFNGLVERTEXARRAYBINDINGDIVISORPROC VertexArrayBindingDivisor; + PFNGLVERTEXARRAYELEMENTBUFFERPROC VertexArrayElementBuffer; + PFNGLVERTEXARRAYVERTEXBUFFERPROC VertexArrayVertexBuffer; + PFNGLVERTEXARRAYVERTEXBUFFERSPROC VertexArrayVertexBuffers; + PFNGLVERTEXATTRIB1DPROC VertexAttrib1d; + PFNGLVERTEXATTRIB1DVPROC VertexAttrib1dv; + PFNGLVERTEXATTRIB1FPROC VertexAttrib1f; + PFNGLVERTEXATTRIB1FVPROC VertexAttrib1fv; + PFNGLVERTEXATTRIB1SPROC VertexAttrib1s; + PFNGLVERTEXATTRIB1SVPROC VertexAttrib1sv; + PFNGLVERTEXATTRIB2DPROC VertexAttrib2d; + PFNGLVERTEXATTRIB2DVPROC VertexAttrib2dv; + PFNGLVERTEXATTRIB2FPROC VertexAttrib2f; + PFNGLVERTEXATTRIB2FVPROC VertexAttrib2fv; + PFNGLVERTEXATTRIB2SPROC VertexAttrib2s; + PFNGLVERTEXATTRIB2SVPROC VertexAttrib2sv; + PFNGLVERTEXATTRIB3DPROC VertexAttrib3d; + PFNGLVERTEXATTRIB3DVPROC VertexAttrib3dv; + PFNGLVERTEXATTRIB3FPROC VertexAttrib3f; + PFNGLVERTEXATTRIB3FVPROC VertexAttrib3fv; + PFNGLVERTEXATTRIB3SPROC VertexAttrib3s; + PFNGLVERTEXATTRIB3SVPROC VertexAttrib3sv; + PFNGLVERTEXATTRIB4NBVPROC VertexAttrib4Nbv; + PFNGLVERTEXATTRIB4NIVPROC VertexAttrib4Niv; + PFNGLVERTEXATTRIB4NSVPROC VertexAttrib4Nsv; + PFNGLVERTEXATTRIB4NUBPROC VertexAttrib4Nub; + PFNGLVERTEXATTRIB4NUBVPROC VertexAttrib4Nubv; + PFNGLVERTEXATTRIB4NUIVPROC VertexAttrib4Nuiv; + PFNGLVERTEXATTRIB4NUSVPROC VertexAttrib4Nusv; + PFNGLVERTEXATTRIB4BVPROC VertexAttrib4bv; + PFNGLVERTEXATTRIB4DPROC VertexAttrib4d; + PFNGLVERTEXATTRIB4DVPROC VertexAttrib4dv; + PFNGLVERTEXATTRIB4FPROC VertexAttrib4f; + PFNGLVERTEXATTRIB4FVPROC VertexAttrib4fv; + PFNGLVERTEXATTRIB4IVPROC VertexAttrib4iv; + PFNGLVERTEXATTRIB4SPROC VertexAttrib4s; + PFNGLVERTEXATTRIB4SVPROC VertexAttrib4sv; + PFNGLVERTEXATTRIB4UBVPROC VertexAttrib4ubv; + PFNGLVERTEXATTRIB4UIVPROC VertexAttrib4uiv; + PFNGLVERTEXATTRIB4USVPROC VertexAttrib4usv; + PFNGLVERTEXATTRIBBINDINGPROC VertexAttribBinding; + PFNGLVERTEXATTRIBDIVISORPROC VertexAttribDivisor; + PFNGLVERTEXATTRIBFORMATPROC VertexAttribFormat; + PFNGLVERTEXATTRIBI1IPROC VertexAttribI1i; + PFNGLVERTEXATTRIBI1IVPROC VertexAttribI1iv; + PFNGLVERTEXATTRIBI1UIPROC VertexAttribI1ui; + PFNGLVERTEXATTRIBI1UIVPROC VertexAttribI1uiv; + PFNGLVERTEXATTRIBI2IPROC VertexAttribI2i; + PFNGLVERTEXATTRIBI2IVPROC VertexAttribI2iv; + PFNGLVERTEXATTRIBI2UIPROC VertexAttribI2ui; + PFNGLVERTEXATTRIBI2UIVPROC VertexAttribI2uiv; + PFNGLVERTEXATTRIBI3IPROC VertexAttribI3i; + PFNGLVERTEXATTRIBI3IVPROC VertexAttribI3iv; + PFNGLVERTEXATTRIBI3UIPROC VertexAttribI3ui; + PFNGLVERTEXATTRIBI3UIVPROC VertexAttribI3uiv; + PFNGLVERTEXATTRIBI4BVPROC VertexAttribI4bv; + PFNGLVERTEXATTRIBI4IPROC VertexAttribI4i; + PFNGLVERTEXATTRIBI4IVPROC VertexAttribI4iv; + PFNGLVERTEXATTRIBI4SVPROC VertexAttribI4sv; + PFNGLVERTEXATTRIBI4UBVPROC VertexAttribI4ubv; + PFNGLVERTEXATTRIBI4UIPROC VertexAttribI4ui; + PFNGLVERTEXATTRIBI4UIVPROC VertexAttribI4uiv; + PFNGLVERTEXATTRIBI4USVPROC VertexAttribI4usv; + PFNGLVERTEXATTRIBIFORMATPROC VertexAttribIFormat; + PFNGLVERTEXATTRIBIPOINTERPROC VertexAttribIPointer; + PFNGLVERTEXATTRIBL1DPROC VertexAttribL1d; + PFNGLVERTEXATTRIBL1DVPROC VertexAttribL1dv; + PFNGLVERTEXATTRIBL2DPROC VertexAttribL2d; + PFNGLVERTEXATTRIBL2DVPROC VertexAttribL2dv; + PFNGLVERTEXATTRIBL3DPROC VertexAttribL3d; + PFNGLVERTEXATTRIBL3DVPROC VertexAttribL3dv; + PFNGLVERTEXATTRIBL4DPROC VertexAttribL4d; + PFNGLVERTEXATTRIBL4DVPROC VertexAttribL4dv; + PFNGLVERTEXATTRIBLFORMATPROC VertexAttribLFormat; + PFNGLVERTEXATTRIBLPOINTERPROC VertexAttribLPointer; + PFNGLVERTEXATTRIBP1UIPROC VertexAttribP1ui; + PFNGLVERTEXATTRIBP1UIVPROC VertexAttribP1uiv; + PFNGLVERTEXATTRIBP2UIPROC VertexAttribP2ui; + PFNGLVERTEXATTRIBP2UIVPROC VertexAttribP2uiv; + PFNGLVERTEXATTRIBP3UIPROC VertexAttribP3ui; + PFNGLVERTEXATTRIBP3UIVPROC VertexAttribP3uiv; + PFNGLVERTEXATTRIBP4UIPROC VertexAttribP4ui; + PFNGLVERTEXATTRIBP4UIVPROC VertexAttribP4uiv; + PFNGLVERTEXATTRIBPOINTERPROC VertexAttribPointer; + PFNGLVERTEXBINDINGDIVISORPROC VertexBindingDivisor; + PFNGLVIEWPORTPROC Viewport; + PFNGLVIEWPORTARRAYVPROC ViewportArrayv; + PFNGLVIEWPORTINDEXEDFPROC ViewportIndexedf; + PFNGLVIEWPORTINDEXEDFVPROC ViewportIndexedfv; + PFNGLWAITSYNCPROC WaitSync; + } gl; +}; + +GL3W_API extern union GL3WProcs gl3wProcs; + +/* OpenGL functions */ +#define glActiveShaderProgram gl3wProcs.gl.ActiveShaderProgram +#define glActiveTexture gl3wProcs.gl.ActiveTexture +#define glAttachShader gl3wProcs.gl.AttachShader +#define glBeginConditionalRender gl3wProcs.gl.BeginConditionalRender +#define glBeginQuery gl3wProcs.gl.BeginQuery +#define glBeginQueryIndexed gl3wProcs.gl.BeginQueryIndexed +#define glBeginTransformFeedback gl3wProcs.gl.BeginTransformFeedback +#define glBindAttribLocation gl3wProcs.gl.BindAttribLocation +#define glBindBuffer gl3wProcs.gl.BindBuffer +#define glBindBufferBase gl3wProcs.gl.BindBufferBase +#define glBindBufferRange gl3wProcs.gl.BindBufferRange +#define glBindBuffersBase gl3wProcs.gl.BindBuffersBase +#define glBindBuffersRange gl3wProcs.gl.BindBuffersRange +#define glBindFragDataLocation gl3wProcs.gl.BindFragDataLocation +#define glBindFragDataLocationIndexed gl3wProcs.gl.BindFragDataLocationIndexed +#define glBindFramebuffer gl3wProcs.gl.BindFramebuffer +#define glBindImageTexture gl3wProcs.gl.BindImageTexture +#define glBindImageTextures gl3wProcs.gl.BindImageTextures +#define glBindProgramPipeline gl3wProcs.gl.BindProgramPipeline +#define glBindRenderbuffer gl3wProcs.gl.BindRenderbuffer +#define glBindSampler gl3wProcs.gl.BindSampler +#define glBindSamplers gl3wProcs.gl.BindSamplers +#define glBindTexture gl3wProcs.gl.BindTexture +#define glBindTextureUnit gl3wProcs.gl.BindTextureUnit +#define glBindTextures gl3wProcs.gl.BindTextures +#define glBindTransformFeedback gl3wProcs.gl.BindTransformFeedback +#define glBindVertexArray gl3wProcs.gl.BindVertexArray +#define glBindVertexBuffer gl3wProcs.gl.BindVertexBuffer +#define glBindVertexBuffers gl3wProcs.gl.BindVertexBuffers +#define glBlendColor gl3wProcs.gl.BlendColor +#define glBlendEquation gl3wProcs.gl.BlendEquation +#define glBlendEquationSeparate gl3wProcs.gl.BlendEquationSeparate +#define glBlendEquationSeparatei gl3wProcs.gl.BlendEquationSeparatei +#define glBlendEquationi gl3wProcs.gl.BlendEquationi +#define glBlendFunc gl3wProcs.gl.BlendFunc +#define glBlendFuncSeparate gl3wProcs.gl.BlendFuncSeparate +#define glBlendFuncSeparatei gl3wProcs.gl.BlendFuncSeparatei +#define glBlendFunci gl3wProcs.gl.BlendFunci +#define glBlitFramebuffer gl3wProcs.gl.BlitFramebuffer +#define glBlitNamedFramebuffer gl3wProcs.gl.BlitNamedFramebuffer +#define glBufferData gl3wProcs.gl.BufferData +#define glBufferStorage gl3wProcs.gl.BufferStorage +#define glBufferSubData gl3wProcs.gl.BufferSubData +#define glCheckFramebufferStatus gl3wProcs.gl.CheckFramebufferStatus +#define glCheckNamedFramebufferStatus gl3wProcs.gl.CheckNamedFramebufferStatus +#define glClampColor gl3wProcs.gl.ClampColor +#define glClear gl3wProcs.gl.Clear +#define glClearBufferData gl3wProcs.gl.ClearBufferData +#define glClearBufferSubData gl3wProcs.gl.ClearBufferSubData +#define glClearBufferfi gl3wProcs.gl.ClearBufferfi +#define glClearBufferfv gl3wProcs.gl.ClearBufferfv +#define glClearBufferiv gl3wProcs.gl.ClearBufferiv +#define glClearBufferuiv gl3wProcs.gl.ClearBufferuiv +#define glClearColor gl3wProcs.gl.ClearColor +#define glClearDepth gl3wProcs.gl.ClearDepth +#define glClearDepthf gl3wProcs.gl.ClearDepthf +#define glClearNamedBufferData gl3wProcs.gl.ClearNamedBufferData +#define glClearNamedBufferSubData gl3wProcs.gl.ClearNamedBufferSubData +#define glClearNamedFramebufferfi gl3wProcs.gl.ClearNamedFramebufferfi +#define glClearNamedFramebufferfv gl3wProcs.gl.ClearNamedFramebufferfv +#define glClearNamedFramebufferiv gl3wProcs.gl.ClearNamedFramebufferiv +#define glClearNamedFramebufferuiv gl3wProcs.gl.ClearNamedFramebufferuiv +#define glClearStencil gl3wProcs.gl.ClearStencil +#define glClearTexImage gl3wProcs.gl.ClearTexImage +#define glClearTexSubImage gl3wProcs.gl.ClearTexSubImage +#define glClientWaitSync gl3wProcs.gl.ClientWaitSync +#define glClipControl gl3wProcs.gl.ClipControl +#define glColorMask gl3wProcs.gl.ColorMask +#define glColorMaski gl3wProcs.gl.ColorMaski +#define glCompileShader gl3wProcs.gl.CompileShader +#define glCompressedTexImage1D gl3wProcs.gl.CompressedTexImage1D +#define glCompressedTexImage2D gl3wProcs.gl.CompressedTexImage2D +#define glCompressedTexImage3D gl3wProcs.gl.CompressedTexImage3D +#define glCompressedTexSubImage1D gl3wProcs.gl.CompressedTexSubImage1D +#define glCompressedTexSubImage2D gl3wProcs.gl.CompressedTexSubImage2D +#define glCompressedTexSubImage3D gl3wProcs.gl.CompressedTexSubImage3D +#define glCompressedTextureSubImage1D gl3wProcs.gl.CompressedTextureSubImage1D +#define glCompressedTextureSubImage2D gl3wProcs.gl.CompressedTextureSubImage2D +#define glCompressedTextureSubImage3D gl3wProcs.gl.CompressedTextureSubImage3D +#define glCopyBufferSubData gl3wProcs.gl.CopyBufferSubData +#define glCopyImageSubData gl3wProcs.gl.CopyImageSubData +#define glCopyNamedBufferSubData gl3wProcs.gl.CopyNamedBufferSubData +#define glCopyTexImage1D gl3wProcs.gl.CopyTexImage1D +#define glCopyTexImage2D gl3wProcs.gl.CopyTexImage2D +#define glCopyTexSubImage1D gl3wProcs.gl.CopyTexSubImage1D +#define glCopyTexSubImage2D gl3wProcs.gl.CopyTexSubImage2D +#define glCopyTexSubImage3D gl3wProcs.gl.CopyTexSubImage3D +#define glCopyTextureSubImage1D gl3wProcs.gl.CopyTextureSubImage1D +#define glCopyTextureSubImage2D gl3wProcs.gl.CopyTextureSubImage2D +#define glCopyTextureSubImage3D gl3wProcs.gl.CopyTextureSubImage3D +#define glCreateBuffers gl3wProcs.gl.CreateBuffers +#define glCreateFramebuffers gl3wProcs.gl.CreateFramebuffers +#define glCreateProgram gl3wProcs.gl.CreateProgram +#define glCreateProgramPipelines gl3wProcs.gl.CreateProgramPipelines +#define glCreateQueries gl3wProcs.gl.CreateQueries +#define glCreateRenderbuffers gl3wProcs.gl.CreateRenderbuffers +#define glCreateSamplers gl3wProcs.gl.CreateSamplers +#define glCreateShader gl3wProcs.gl.CreateShader +#define glCreateShaderProgramv gl3wProcs.gl.CreateShaderProgramv +#define glCreateTextures gl3wProcs.gl.CreateTextures +#define glCreateTransformFeedbacks gl3wProcs.gl.CreateTransformFeedbacks +#define glCreateVertexArrays gl3wProcs.gl.CreateVertexArrays +#define glCullFace gl3wProcs.gl.CullFace +#define glDebugMessageCallback gl3wProcs.gl.DebugMessageCallback +#define glDebugMessageControl gl3wProcs.gl.DebugMessageControl +#define glDebugMessageInsert gl3wProcs.gl.DebugMessageInsert +#define glDeleteBuffers gl3wProcs.gl.DeleteBuffers +#define glDeleteFramebuffers gl3wProcs.gl.DeleteFramebuffers +#define glDeleteProgram gl3wProcs.gl.DeleteProgram +#define glDeleteProgramPipelines gl3wProcs.gl.DeleteProgramPipelines +#define glDeleteQueries gl3wProcs.gl.DeleteQueries +#define glDeleteRenderbuffers gl3wProcs.gl.DeleteRenderbuffers +#define glDeleteSamplers gl3wProcs.gl.DeleteSamplers +#define glDeleteShader gl3wProcs.gl.DeleteShader +#define glDeleteSync gl3wProcs.gl.DeleteSync +#define glDeleteTextures gl3wProcs.gl.DeleteTextures +#define glDeleteTransformFeedbacks gl3wProcs.gl.DeleteTransformFeedbacks +#define glDeleteVertexArrays gl3wProcs.gl.DeleteVertexArrays +#define glDepthFunc gl3wProcs.gl.DepthFunc +#define glDepthMask gl3wProcs.gl.DepthMask +#define glDepthRange gl3wProcs.gl.DepthRange +#define glDepthRangeArrayv gl3wProcs.gl.DepthRangeArrayv +#define glDepthRangeIndexed gl3wProcs.gl.DepthRangeIndexed +#define glDepthRangef gl3wProcs.gl.DepthRangef +#define glDetachShader gl3wProcs.gl.DetachShader +#define glDisable gl3wProcs.gl.Disable +#define glDisableVertexArrayAttrib gl3wProcs.gl.DisableVertexArrayAttrib +#define glDisableVertexAttribArray gl3wProcs.gl.DisableVertexAttribArray +#define glDisablei gl3wProcs.gl.Disablei +#define glDispatchCompute gl3wProcs.gl.DispatchCompute +#define glDispatchComputeIndirect gl3wProcs.gl.DispatchComputeIndirect +#define glDrawArrays gl3wProcs.gl.DrawArrays +#define glDrawArraysIndirect gl3wProcs.gl.DrawArraysIndirect +#define glDrawArraysInstanced gl3wProcs.gl.DrawArraysInstanced +#define glDrawArraysInstancedBaseInstance gl3wProcs.gl.DrawArraysInstancedBaseInstance +#define glDrawBuffer gl3wProcs.gl.DrawBuffer +#define glDrawBuffers gl3wProcs.gl.DrawBuffers +#define glDrawElements gl3wProcs.gl.DrawElements +#define glDrawElementsBaseVertex gl3wProcs.gl.DrawElementsBaseVertex +#define glDrawElementsIndirect gl3wProcs.gl.DrawElementsIndirect +#define glDrawElementsInstanced gl3wProcs.gl.DrawElementsInstanced +#define glDrawElementsInstancedBaseInstance gl3wProcs.gl.DrawElementsInstancedBaseInstance +#define glDrawElementsInstancedBaseVertex gl3wProcs.gl.DrawElementsInstancedBaseVertex +#define glDrawElementsInstancedBaseVertexBaseInstance gl3wProcs.gl.DrawElementsInstancedBaseVertexBaseInstance +#define glDrawRangeElements gl3wProcs.gl.DrawRangeElements +#define glDrawRangeElementsBaseVertex gl3wProcs.gl.DrawRangeElementsBaseVertex +#define glDrawTransformFeedback gl3wProcs.gl.DrawTransformFeedback +#define glDrawTransformFeedbackInstanced gl3wProcs.gl.DrawTransformFeedbackInstanced +#define glDrawTransformFeedbackStream gl3wProcs.gl.DrawTransformFeedbackStream +#define glDrawTransformFeedbackStreamInstanced gl3wProcs.gl.DrawTransformFeedbackStreamInstanced +#define glEnable gl3wProcs.gl.Enable +#define glEnableVertexArrayAttrib gl3wProcs.gl.EnableVertexArrayAttrib +#define glEnableVertexAttribArray gl3wProcs.gl.EnableVertexAttribArray +#define glEnablei gl3wProcs.gl.Enablei +#define glEndConditionalRender gl3wProcs.gl.EndConditionalRender +#define glEndQuery gl3wProcs.gl.EndQuery +#define glEndQueryIndexed gl3wProcs.gl.EndQueryIndexed +#define glEndTransformFeedback gl3wProcs.gl.EndTransformFeedback +#define glFenceSync gl3wProcs.gl.FenceSync +#define glFinish gl3wProcs.gl.Finish +#define glFlush gl3wProcs.gl.Flush +#define glFlushMappedBufferRange gl3wProcs.gl.FlushMappedBufferRange +#define glFlushMappedNamedBufferRange gl3wProcs.gl.FlushMappedNamedBufferRange +#define glFramebufferParameteri gl3wProcs.gl.FramebufferParameteri +#define glFramebufferParameteriMESA gl3wProcs.gl.FramebufferParameteriMESA +#define glFramebufferRenderbuffer gl3wProcs.gl.FramebufferRenderbuffer +#define glFramebufferTexture gl3wProcs.gl.FramebufferTexture +#define glFramebufferTexture1D gl3wProcs.gl.FramebufferTexture1D +#define glFramebufferTexture2D gl3wProcs.gl.FramebufferTexture2D +#define glFramebufferTexture3D gl3wProcs.gl.FramebufferTexture3D +#define glFramebufferTextureLayer gl3wProcs.gl.FramebufferTextureLayer +#define glFrontFace gl3wProcs.gl.FrontFace +#define glGenBuffers gl3wProcs.gl.GenBuffers +#define glGenFramebuffers gl3wProcs.gl.GenFramebuffers +#define glGenProgramPipelines gl3wProcs.gl.GenProgramPipelines +#define glGenQueries gl3wProcs.gl.GenQueries +#define glGenRenderbuffers gl3wProcs.gl.GenRenderbuffers +#define glGenSamplers gl3wProcs.gl.GenSamplers +#define glGenTextures gl3wProcs.gl.GenTextures +#define glGenTransformFeedbacks gl3wProcs.gl.GenTransformFeedbacks +#define glGenVertexArrays gl3wProcs.gl.GenVertexArrays +#define glGenerateMipmap gl3wProcs.gl.GenerateMipmap +#define glGenerateTextureMipmap gl3wProcs.gl.GenerateTextureMipmap +#define glGetActiveAtomicCounterBufferiv gl3wProcs.gl.GetActiveAtomicCounterBufferiv +#define glGetActiveAttrib gl3wProcs.gl.GetActiveAttrib +#define glGetActiveSubroutineName gl3wProcs.gl.GetActiveSubroutineName +#define glGetActiveSubroutineUniformName gl3wProcs.gl.GetActiveSubroutineUniformName +#define glGetActiveSubroutineUniformiv gl3wProcs.gl.GetActiveSubroutineUniformiv +#define glGetActiveUniform gl3wProcs.gl.GetActiveUniform +#define glGetActiveUniformBlockName gl3wProcs.gl.GetActiveUniformBlockName +#define glGetActiveUniformBlockiv gl3wProcs.gl.GetActiveUniformBlockiv +#define glGetActiveUniformName gl3wProcs.gl.GetActiveUniformName +#define glGetActiveUniformsiv gl3wProcs.gl.GetActiveUniformsiv +#define glGetAttachedShaders gl3wProcs.gl.GetAttachedShaders +#define glGetAttribLocation gl3wProcs.gl.GetAttribLocation +#define glGetBooleani_v gl3wProcs.gl.GetBooleani_v +#define glGetBooleanv gl3wProcs.gl.GetBooleanv +#define glGetBufferParameteri64v gl3wProcs.gl.GetBufferParameteri64v +#define glGetBufferParameteriv gl3wProcs.gl.GetBufferParameteriv +#define glGetBufferPointerv gl3wProcs.gl.GetBufferPointerv +#define glGetBufferSubData gl3wProcs.gl.GetBufferSubData +#define glGetCompressedTexImage gl3wProcs.gl.GetCompressedTexImage +#define glGetCompressedTextureImage gl3wProcs.gl.GetCompressedTextureImage +#define glGetCompressedTextureSubImage gl3wProcs.gl.GetCompressedTextureSubImage +#define glGetDebugMessageLog gl3wProcs.gl.GetDebugMessageLog +#define glGetDoublei_v gl3wProcs.gl.GetDoublei_v +#define glGetDoublev gl3wProcs.gl.GetDoublev +#define glGetError gl3wProcs.gl.GetError +#define glGetFloati_v gl3wProcs.gl.GetFloati_v +#define glGetFloatv gl3wProcs.gl.GetFloatv +#define glGetFragDataIndex gl3wProcs.gl.GetFragDataIndex +#define glGetFragDataLocation gl3wProcs.gl.GetFragDataLocation +#define glGetFramebufferAttachmentParameteriv gl3wProcs.gl.GetFramebufferAttachmentParameteriv +#define glGetFramebufferParameteriv gl3wProcs.gl.GetFramebufferParameteriv +#define glGetFramebufferParameterivMESA gl3wProcs.gl.GetFramebufferParameterivMESA +#define glGetGraphicsResetStatus gl3wProcs.gl.GetGraphicsResetStatus +#define glGetInteger64i_v gl3wProcs.gl.GetInteger64i_v +#define glGetInteger64v gl3wProcs.gl.GetInteger64v +#define glGetIntegeri_v gl3wProcs.gl.GetIntegeri_v +#define glGetIntegerv gl3wProcs.gl.GetIntegerv +#define glGetInternalformati64v gl3wProcs.gl.GetInternalformati64v +#define glGetInternalformativ gl3wProcs.gl.GetInternalformativ +#define glGetMultisamplefv gl3wProcs.gl.GetMultisamplefv +#define glGetNamedBufferParameteri64v gl3wProcs.gl.GetNamedBufferParameteri64v +#define glGetNamedBufferParameteriv gl3wProcs.gl.GetNamedBufferParameteriv +#define glGetNamedBufferPointerv gl3wProcs.gl.GetNamedBufferPointerv +#define glGetNamedBufferSubData gl3wProcs.gl.GetNamedBufferSubData +#define glGetNamedFramebufferAttachmentParameteriv gl3wProcs.gl.GetNamedFramebufferAttachmentParameteriv +#define glGetNamedFramebufferParameteriv gl3wProcs.gl.GetNamedFramebufferParameteriv +#define glGetNamedRenderbufferParameteriv gl3wProcs.gl.GetNamedRenderbufferParameteriv +#define glGetObjectLabel gl3wProcs.gl.GetObjectLabel +#define glGetObjectPtrLabel gl3wProcs.gl.GetObjectPtrLabel +#define glGetPointerv gl3wProcs.gl.GetPointerv +#define glGetProgramBinary gl3wProcs.gl.GetProgramBinary +#define glGetProgramInfoLog gl3wProcs.gl.GetProgramInfoLog +#define glGetProgramInterfaceiv gl3wProcs.gl.GetProgramInterfaceiv +#define glGetProgramPipelineInfoLog gl3wProcs.gl.GetProgramPipelineInfoLog +#define glGetProgramPipelineiv gl3wProcs.gl.GetProgramPipelineiv +#define glGetProgramResourceIndex gl3wProcs.gl.GetProgramResourceIndex +#define glGetProgramResourceLocation gl3wProcs.gl.GetProgramResourceLocation +#define glGetProgramResourceLocationIndex gl3wProcs.gl.GetProgramResourceLocationIndex +#define glGetProgramResourceName gl3wProcs.gl.GetProgramResourceName +#define glGetProgramResourceiv gl3wProcs.gl.GetProgramResourceiv +#define glGetProgramStageiv gl3wProcs.gl.GetProgramStageiv +#define glGetProgramiv gl3wProcs.gl.GetProgramiv +#define glGetQueryBufferObjecti64v gl3wProcs.gl.GetQueryBufferObjecti64v +#define glGetQueryBufferObjectiv gl3wProcs.gl.GetQueryBufferObjectiv +#define glGetQueryBufferObjectui64v gl3wProcs.gl.GetQueryBufferObjectui64v +#define glGetQueryBufferObjectuiv gl3wProcs.gl.GetQueryBufferObjectuiv +#define glGetQueryIndexediv gl3wProcs.gl.GetQueryIndexediv +#define glGetQueryObjecti64v gl3wProcs.gl.GetQueryObjecti64v +#define glGetQueryObjectiv gl3wProcs.gl.GetQueryObjectiv +#define glGetQueryObjectui64v gl3wProcs.gl.GetQueryObjectui64v +#define glGetQueryObjectuiv gl3wProcs.gl.GetQueryObjectuiv +#define glGetQueryiv gl3wProcs.gl.GetQueryiv +#define glGetRenderbufferParameteriv gl3wProcs.gl.GetRenderbufferParameteriv +#define glGetSamplerParameterIiv gl3wProcs.gl.GetSamplerParameterIiv +#define glGetSamplerParameterIuiv gl3wProcs.gl.GetSamplerParameterIuiv +#define glGetSamplerParameterfv gl3wProcs.gl.GetSamplerParameterfv +#define glGetSamplerParameteriv gl3wProcs.gl.GetSamplerParameteriv +#define glGetShaderInfoLog gl3wProcs.gl.GetShaderInfoLog +#define glGetShaderPrecisionFormat gl3wProcs.gl.GetShaderPrecisionFormat +#define glGetShaderSource gl3wProcs.gl.GetShaderSource +#define glGetShaderiv gl3wProcs.gl.GetShaderiv +#define glGetString gl3wProcs.gl.GetString +#define glGetStringi gl3wProcs.gl.GetStringi +#define glGetSubroutineIndex gl3wProcs.gl.GetSubroutineIndex +#define glGetSubroutineUniformLocation gl3wProcs.gl.GetSubroutineUniformLocation +#define glGetSynciv gl3wProcs.gl.GetSynciv +#define glGetTexImage gl3wProcs.gl.GetTexImage +#define glGetTexLevelParameterfv gl3wProcs.gl.GetTexLevelParameterfv +#define glGetTexLevelParameteriv gl3wProcs.gl.GetTexLevelParameteriv +#define glGetTexParameterIiv gl3wProcs.gl.GetTexParameterIiv +#define glGetTexParameterIuiv gl3wProcs.gl.GetTexParameterIuiv +#define glGetTexParameterfv gl3wProcs.gl.GetTexParameterfv +#define glGetTexParameteriv gl3wProcs.gl.GetTexParameteriv +#define glGetTextureImage gl3wProcs.gl.GetTextureImage +#define glGetTextureLevelParameterfv gl3wProcs.gl.GetTextureLevelParameterfv +#define glGetTextureLevelParameteriv gl3wProcs.gl.GetTextureLevelParameteriv +#define glGetTextureParameterIiv gl3wProcs.gl.GetTextureParameterIiv +#define glGetTextureParameterIuiv gl3wProcs.gl.GetTextureParameterIuiv +#define glGetTextureParameterfv gl3wProcs.gl.GetTextureParameterfv +#define glGetTextureParameteriv gl3wProcs.gl.GetTextureParameteriv +#define glGetTextureSubImage gl3wProcs.gl.GetTextureSubImage +#define glGetTransformFeedbackVarying gl3wProcs.gl.GetTransformFeedbackVarying +#define glGetTransformFeedbacki64_v gl3wProcs.gl.GetTransformFeedbacki64_v +#define glGetTransformFeedbacki_v gl3wProcs.gl.GetTransformFeedbacki_v +#define glGetTransformFeedbackiv gl3wProcs.gl.GetTransformFeedbackiv +#define glGetUniformBlockIndex gl3wProcs.gl.GetUniformBlockIndex +#define glGetUniformIndices gl3wProcs.gl.GetUniformIndices +#define glGetUniformLocation gl3wProcs.gl.GetUniformLocation +#define glGetUniformSubroutineuiv gl3wProcs.gl.GetUniformSubroutineuiv +#define glGetUniformdv gl3wProcs.gl.GetUniformdv +#define glGetUniformfv gl3wProcs.gl.GetUniformfv +#define glGetUniformiv gl3wProcs.gl.GetUniformiv +#define glGetUniformuiv gl3wProcs.gl.GetUniformuiv +#define glGetVertexArrayIndexed64iv gl3wProcs.gl.GetVertexArrayIndexed64iv +#define glGetVertexArrayIndexediv gl3wProcs.gl.GetVertexArrayIndexediv +#define glGetVertexArrayiv gl3wProcs.gl.GetVertexArrayiv +#define glGetVertexAttribIiv gl3wProcs.gl.GetVertexAttribIiv +#define glGetVertexAttribIuiv gl3wProcs.gl.GetVertexAttribIuiv +#define glGetVertexAttribLdv gl3wProcs.gl.GetVertexAttribLdv +#define glGetVertexAttribPointerv gl3wProcs.gl.GetVertexAttribPointerv +#define glGetVertexAttribdv gl3wProcs.gl.GetVertexAttribdv +#define glGetVertexAttribfv gl3wProcs.gl.GetVertexAttribfv +#define glGetVertexAttribiv gl3wProcs.gl.GetVertexAttribiv +#define glGetnCompressedTexImage gl3wProcs.gl.GetnCompressedTexImage +#define glGetnTexImage gl3wProcs.gl.GetnTexImage +#define glGetnUniformdv gl3wProcs.gl.GetnUniformdv +#define glGetnUniformfv gl3wProcs.gl.GetnUniformfv +#define glGetnUniformiv gl3wProcs.gl.GetnUniformiv +#define glGetnUniformuiv gl3wProcs.gl.GetnUniformuiv +#define glHint gl3wProcs.gl.Hint +#define glInvalidateBufferData gl3wProcs.gl.InvalidateBufferData +#define glInvalidateBufferSubData gl3wProcs.gl.InvalidateBufferSubData +#define glInvalidateFramebuffer gl3wProcs.gl.InvalidateFramebuffer +#define glInvalidateNamedFramebufferData gl3wProcs.gl.InvalidateNamedFramebufferData +#define glInvalidateNamedFramebufferSubData gl3wProcs.gl.InvalidateNamedFramebufferSubData +#define glInvalidateSubFramebuffer gl3wProcs.gl.InvalidateSubFramebuffer +#define glInvalidateTexImage gl3wProcs.gl.InvalidateTexImage +#define glInvalidateTexSubImage gl3wProcs.gl.InvalidateTexSubImage +#define glIsBuffer gl3wProcs.gl.IsBuffer +#define glIsEnabled gl3wProcs.gl.IsEnabled +#define glIsEnabledi gl3wProcs.gl.IsEnabledi +#define glIsFramebuffer gl3wProcs.gl.IsFramebuffer +#define glIsProgram gl3wProcs.gl.IsProgram +#define glIsProgramPipeline gl3wProcs.gl.IsProgramPipeline +#define glIsQuery gl3wProcs.gl.IsQuery +#define glIsRenderbuffer gl3wProcs.gl.IsRenderbuffer +#define glIsSampler gl3wProcs.gl.IsSampler +#define glIsShader gl3wProcs.gl.IsShader +#define glIsSync gl3wProcs.gl.IsSync +#define glIsTexture gl3wProcs.gl.IsTexture +#define glIsTransformFeedback gl3wProcs.gl.IsTransformFeedback +#define glIsVertexArray gl3wProcs.gl.IsVertexArray +#define glLineWidth gl3wProcs.gl.LineWidth +#define glLinkProgram gl3wProcs.gl.LinkProgram +#define glLogicOp gl3wProcs.gl.LogicOp +#define glMapBuffer gl3wProcs.gl.MapBuffer +#define glMapBufferRange gl3wProcs.gl.MapBufferRange +#define glMapNamedBuffer gl3wProcs.gl.MapNamedBuffer +#define glMapNamedBufferRange gl3wProcs.gl.MapNamedBufferRange +#define glMemoryBarrier gl3wProcs.gl.MemoryBarrier +#define glMemoryBarrierByRegion gl3wProcs.gl.MemoryBarrierByRegion +#define glMinSampleShading gl3wProcs.gl.MinSampleShading +#define glMultiDrawArrays gl3wProcs.gl.MultiDrawArrays +#define glMultiDrawArraysIndirect gl3wProcs.gl.MultiDrawArraysIndirect +#define glMultiDrawArraysIndirectCount gl3wProcs.gl.MultiDrawArraysIndirectCount +#define glMultiDrawElements gl3wProcs.gl.MultiDrawElements +#define glMultiDrawElementsBaseVertex gl3wProcs.gl.MultiDrawElementsBaseVertex +#define glMultiDrawElementsIndirect gl3wProcs.gl.MultiDrawElementsIndirect +#define glMultiDrawElementsIndirectCount gl3wProcs.gl.MultiDrawElementsIndirectCount +#define glNamedBufferData gl3wProcs.gl.NamedBufferData +#define glNamedBufferStorage gl3wProcs.gl.NamedBufferStorage +#define glNamedBufferSubData gl3wProcs.gl.NamedBufferSubData +#define glNamedFramebufferDrawBuffer gl3wProcs.gl.NamedFramebufferDrawBuffer +#define glNamedFramebufferDrawBuffers gl3wProcs.gl.NamedFramebufferDrawBuffers +#define glNamedFramebufferParameteri gl3wProcs.gl.NamedFramebufferParameteri +#define glNamedFramebufferReadBuffer gl3wProcs.gl.NamedFramebufferReadBuffer +#define glNamedFramebufferRenderbuffer gl3wProcs.gl.NamedFramebufferRenderbuffer +#define glNamedFramebufferTexture gl3wProcs.gl.NamedFramebufferTexture +#define glNamedFramebufferTextureLayer gl3wProcs.gl.NamedFramebufferTextureLayer +#define glNamedRenderbufferStorage gl3wProcs.gl.NamedRenderbufferStorage +#define glNamedRenderbufferStorageMultisample gl3wProcs.gl.NamedRenderbufferStorageMultisample +#define glObjectLabel gl3wProcs.gl.ObjectLabel +#define glObjectPtrLabel gl3wProcs.gl.ObjectPtrLabel +#define glPatchParameterfv gl3wProcs.gl.PatchParameterfv +#define glPatchParameteri gl3wProcs.gl.PatchParameteri +#define glPauseTransformFeedback gl3wProcs.gl.PauseTransformFeedback +#define glPixelStoref gl3wProcs.gl.PixelStoref +#define glPixelStorei gl3wProcs.gl.PixelStorei +#define glPointParameterf gl3wProcs.gl.PointParameterf +#define glPointParameterfv gl3wProcs.gl.PointParameterfv +#define glPointParameteri gl3wProcs.gl.PointParameteri +#define glPointParameteriv gl3wProcs.gl.PointParameteriv +#define glPointSize gl3wProcs.gl.PointSize +#define glPolygonMode gl3wProcs.gl.PolygonMode +#define glPolygonOffset gl3wProcs.gl.PolygonOffset +#define glPolygonOffsetClamp gl3wProcs.gl.PolygonOffsetClamp +#define glPopDebugGroup gl3wProcs.gl.PopDebugGroup +#define glPrimitiveRestartIndex gl3wProcs.gl.PrimitiveRestartIndex +#define glProgramBinary gl3wProcs.gl.ProgramBinary +#define glProgramParameteri gl3wProcs.gl.ProgramParameteri +#define glProgramUniform1d gl3wProcs.gl.ProgramUniform1d +#define glProgramUniform1dv gl3wProcs.gl.ProgramUniform1dv +#define glProgramUniform1f gl3wProcs.gl.ProgramUniform1f +#define glProgramUniform1fv gl3wProcs.gl.ProgramUniform1fv +#define glProgramUniform1i gl3wProcs.gl.ProgramUniform1i +#define glProgramUniform1iv gl3wProcs.gl.ProgramUniform1iv +#define glProgramUniform1ui gl3wProcs.gl.ProgramUniform1ui +#define glProgramUniform1uiv gl3wProcs.gl.ProgramUniform1uiv +#define glProgramUniform2d gl3wProcs.gl.ProgramUniform2d +#define glProgramUniform2dv gl3wProcs.gl.ProgramUniform2dv +#define glProgramUniform2f gl3wProcs.gl.ProgramUniform2f +#define glProgramUniform2fv gl3wProcs.gl.ProgramUniform2fv +#define glProgramUniform2i gl3wProcs.gl.ProgramUniform2i +#define glProgramUniform2iv gl3wProcs.gl.ProgramUniform2iv +#define glProgramUniform2ui gl3wProcs.gl.ProgramUniform2ui +#define glProgramUniform2uiv gl3wProcs.gl.ProgramUniform2uiv +#define glProgramUniform3d gl3wProcs.gl.ProgramUniform3d +#define glProgramUniform3dv gl3wProcs.gl.ProgramUniform3dv +#define glProgramUniform3f gl3wProcs.gl.ProgramUniform3f +#define glProgramUniform3fv gl3wProcs.gl.ProgramUniform3fv +#define glProgramUniform3i gl3wProcs.gl.ProgramUniform3i +#define glProgramUniform3iv gl3wProcs.gl.ProgramUniform3iv +#define glProgramUniform3ui gl3wProcs.gl.ProgramUniform3ui +#define glProgramUniform3uiv gl3wProcs.gl.ProgramUniform3uiv +#define glProgramUniform4d gl3wProcs.gl.ProgramUniform4d +#define glProgramUniform4dv gl3wProcs.gl.ProgramUniform4dv +#define glProgramUniform4f gl3wProcs.gl.ProgramUniform4f +#define glProgramUniform4fv gl3wProcs.gl.ProgramUniform4fv +#define glProgramUniform4i gl3wProcs.gl.ProgramUniform4i +#define glProgramUniform4iv gl3wProcs.gl.ProgramUniform4iv +#define glProgramUniform4ui gl3wProcs.gl.ProgramUniform4ui +#define glProgramUniform4uiv gl3wProcs.gl.ProgramUniform4uiv +#define glProgramUniformMatrix2dv gl3wProcs.gl.ProgramUniformMatrix2dv +#define glProgramUniformMatrix2fv gl3wProcs.gl.ProgramUniformMatrix2fv +#define glProgramUniformMatrix2x3dv gl3wProcs.gl.ProgramUniformMatrix2x3dv +#define glProgramUniformMatrix2x3fv gl3wProcs.gl.ProgramUniformMatrix2x3fv +#define glProgramUniformMatrix2x4dv gl3wProcs.gl.ProgramUniformMatrix2x4dv +#define glProgramUniformMatrix2x4fv gl3wProcs.gl.ProgramUniformMatrix2x4fv +#define glProgramUniformMatrix3dv gl3wProcs.gl.ProgramUniformMatrix3dv +#define glProgramUniformMatrix3fv gl3wProcs.gl.ProgramUniformMatrix3fv +#define glProgramUniformMatrix3x2dv gl3wProcs.gl.ProgramUniformMatrix3x2dv +#define glProgramUniformMatrix3x2fv gl3wProcs.gl.ProgramUniformMatrix3x2fv +#define glProgramUniformMatrix3x4dv gl3wProcs.gl.ProgramUniformMatrix3x4dv +#define glProgramUniformMatrix3x4fv gl3wProcs.gl.ProgramUniformMatrix3x4fv +#define glProgramUniformMatrix4dv gl3wProcs.gl.ProgramUniformMatrix4dv +#define glProgramUniformMatrix4fv gl3wProcs.gl.ProgramUniformMatrix4fv +#define glProgramUniformMatrix4x2dv gl3wProcs.gl.ProgramUniformMatrix4x2dv +#define glProgramUniformMatrix4x2fv gl3wProcs.gl.ProgramUniformMatrix4x2fv +#define glProgramUniformMatrix4x3dv gl3wProcs.gl.ProgramUniformMatrix4x3dv +#define glProgramUniformMatrix4x3fv gl3wProcs.gl.ProgramUniformMatrix4x3fv +#define glProvokingVertex gl3wProcs.gl.ProvokingVertex +#define glPushDebugGroup gl3wProcs.gl.PushDebugGroup +#define glQueryCounter gl3wProcs.gl.QueryCounter +#define glReadBuffer gl3wProcs.gl.ReadBuffer +#define glReadPixels gl3wProcs.gl.ReadPixels +#define glReadnPixels gl3wProcs.gl.ReadnPixels +#define glReleaseShaderCompiler gl3wProcs.gl.ReleaseShaderCompiler +#define glRenderbufferStorage gl3wProcs.gl.RenderbufferStorage +#define glRenderbufferStorageMultisample gl3wProcs.gl.RenderbufferStorageMultisample +#define glResumeTransformFeedback gl3wProcs.gl.ResumeTransformFeedback +#define glSampleCoverage gl3wProcs.gl.SampleCoverage +#define glSampleMaski gl3wProcs.gl.SampleMaski +#define glSamplerParameterIiv gl3wProcs.gl.SamplerParameterIiv +#define glSamplerParameterIuiv gl3wProcs.gl.SamplerParameterIuiv +#define glSamplerParameterf gl3wProcs.gl.SamplerParameterf +#define glSamplerParameterfv gl3wProcs.gl.SamplerParameterfv +#define glSamplerParameteri gl3wProcs.gl.SamplerParameteri +#define glSamplerParameteriv gl3wProcs.gl.SamplerParameteriv +#define glScissor gl3wProcs.gl.Scissor +#define glScissorArrayv gl3wProcs.gl.ScissorArrayv +#define glScissorIndexed gl3wProcs.gl.ScissorIndexed +#define glScissorIndexedv gl3wProcs.gl.ScissorIndexedv +#define glShaderBinary gl3wProcs.gl.ShaderBinary +#define glShaderSource gl3wProcs.gl.ShaderSource +#define glShaderStorageBlockBinding gl3wProcs.gl.ShaderStorageBlockBinding +#define glSpecializeShader gl3wProcs.gl.SpecializeShader +#define glStencilFunc gl3wProcs.gl.StencilFunc +#define glStencilFuncSeparate gl3wProcs.gl.StencilFuncSeparate +#define glStencilMask gl3wProcs.gl.StencilMask +#define glStencilMaskSeparate gl3wProcs.gl.StencilMaskSeparate +#define glStencilOp gl3wProcs.gl.StencilOp +#define glStencilOpSeparate gl3wProcs.gl.StencilOpSeparate +#define glTexBuffer gl3wProcs.gl.TexBuffer +#define glTexBufferRange gl3wProcs.gl.TexBufferRange +#define glTexImage1D gl3wProcs.gl.TexImage1D +#define glTexImage2D gl3wProcs.gl.TexImage2D +#define glTexImage2DMultisample gl3wProcs.gl.TexImage2DMultisample +#define glTexImage3D gl3wProcs.gl.TexImage3D +#define glTexImage3DMultisample gl3wProcs.gl.TexImage3DMultisample +#define glTexParameterIiv gl3wProcs.gl.TexParameterIiv +#define glTexParameterIuiv gl3wProcs.gl.TexParameterIuiv +#define glTexParameterf gl3wProcs.gl.TexParameterf +#define glTexParameterfv gl3wProcs.gl.TexParameterfv +#define glTexParameteri gl3wProcs.gl.TexParameteri +#define glTexParameteriv gl3wProcs.gl.TexParameteriv +#define glTexStorage1D gl3wProcs.gl.TexStorage1D +#define glTexStorage2D gl3wProcs.gl.TexStorage2D +#define glTexStorage2DMultisample gl3wProcs.gl.TexStorage2DMultisample +#define glTexStorage3D gl3wProcs.gl.TexStorage3D +#define glTexStorage3DMultisample gl3wProcs.gl.TexStorage3DMultisample +#define glTexSubImage1D gl3wProcs.gl.TexSubImage1D +#define glTexSubImage2D gl3wProcs.gl.TexSubImage2D +#define glTexSubImage3D gl3wProcs.gl.TexSubImage3D +#define glTextureBarrier gl3wProcs.gl.TextureBarrier +#define glTextureBuffer gl3wProcs.gl.TextureBuffer +#define glTextureBufferRange gl3wProcs.gl.TextureBufferRange +#define glTextureParameterIiv gl3wProcs.gl.TextureParameterIiv +#define glTextureParameterIuiv gl3wProcs.gl.TextureParameterIuiv +#define glTextureParameterf gl3wProcs.gl.TextureParameterf +#define glTextureParameterfv gl3wProcs.gl.TextureParameterfv +#define glTextureParameteri gl3wProcs.gl.TextureParameteri +#define glTextureParameteriv gl3wProcs.gl.TextureParameteriv +#define glTextureStorage1D gl3wProcs.gl.TextureStorage1D +#define glTextureStorage2D gl3wProcs.gl.TextureStorage2D +#define glTextureStorage2DMultisample gl3wProcs.gl.TextureStorage2DMultisample +#define glTextureStorage3D gl3wProcs.gl.TextureStorage3D +#define glTextureStorage3DMultisample gl3wProcs.gl.TextureStorage3DMultisample +#define glTextureSubImage1D gl3wProcs.gl.TextureSubImage1D +#define glTextureSubImage2D gl3wProcs.gl.TextureSubImage2D +#define glTextureSubImage3D gl3wProcs.gl.TextureSubImage3D +#define glTextureView gl3wProcs.gl.TextureView +#define glTransformFeedbackBufferBase gl3wProcs.gl.TransformFeedbackBufferBase +#define glTransformFeedbackBufferRange gl3wProcs.gl.TransformFeedbackBufferRange +#define glTransformFeedbackVaryings gl3wProcs.gl.TransformFeedbackVaryings +#define glUniform1d gl3wProcs.gl.Uniform1d +#define glUniform1dv gl3wProcs.gl.Uniform1dv +#define glUniform1f gl3wProcs.gl.Uniform1f +#define glUniform1fv gl3wProcs.gl.Uniform1fv +#define glUniform1i gl3wProcs.gl.Uniform1i +#define glUniform1iv gl3wProcs.gl.Uniform1iv +#define glUniform1ui gl3wProcs.gl.Uniform1ui +#define glUniform1uiv gl3wProcs.gl.Uniform1uiv +#define glUniform2d gl3wProcs.gl.Uniform2d +#define glUniform2dv gl3wProcs.gl.Uniform2dv +#define glUniform2f gl3wProcs.gl.Uniform2f +#define glUniform2fv gl3wProcs.gl.Uniform2fv +#define glUniform2i gl3wProcs.gl.Uniform2i +#define glUniform2iv gl3wProcs.gl.Uniform2iv +#define glUniform2ui gl3wProcs.gl.Uniform2ui +#define glUniform2uiv gl3wProcs.gl.Uniform2uiv +#define glUniform3d gl3wProcs.gl.Uniform3d +#define glUniform3dv gl3wProcs.gl.Uniform3dv +#define glUniform3f gl3wProcs.gl.Uniform3f +#define glUniform3fv gl3wProcs.gl.Uniform3fv +#define glUniform3i gl3wProcs.gl.Uniform3i +#define glUniform3iv gl3wProcs.gl.Uniform3iv +#define glUniform3ui gl3wProcs.gl.Uniform3ui +#define glUniform3uiv gl3wProcs.gl.Uniform3uiv +#define glUniform4d gl3wProcs.gl.Uniform4d +#define glUniform4dv gl3wProcs.gl.Uniform4dv +#define glUniform4f gl3wProcs.gl.Uniform4f +#define glUniform4fv gl3wProcs.gl.Uniform4fv +#define glUniform4i gl3wProcs.gl.Uniform4i +#define glUniform4iv gl3wProcs.gl.Uniform4iv +#define glUniform4ui gl3wProcs.gl.Uniform4ui +#define glUniform4uiv gl3wProcs.gl.Uniform4uiv +#define glUniformBlockBinding gl3wProcs.gl.UniformBlockBinding +#define glUniformMatrix2dv gl3wProcs.gl.UniformMatrix2dv +#define glUniformMatrix2fv gl3wProcs.gl.UniformMatrix2fv +#define glUniformMatrix2x3dv gl3wProcs.gl.UniformMatrix2x3dv +#define glUniformMatrix2x3fv gl3wProcs.gl.UniformMatrix2x3fv +#define glUniformMatrix2x4dv gl3wProcs.gl.UniformMatrix2x4dv +#define glUniformMatrix2x4fv gl3wProcs.gl.UniformMatrix2x4fv +#define glUniformMatrix3dv gl3wProcs.gl.UniformMatrix3dv +#define glUniformMatrix3fv gl3wProcs.gl.UniformMatrix3fv +#define glUniformMatrix3x2dv gl3wProcs.gl.UniformMatrix3x2dv +#define glUniformMatrix3x2fv gl3wProcs.gl.UniformMatrix3x2fv +#define glUniformMatrix3x4dv gl3wProcs.gl.UniformMatrix3x4dv +#define glUniformMatrix3x4fv gl3wProcs.gl.UniformMatrix3x4fv +#define glUniformMatrix4dv gl3wProcs.gl.UniformMatrix4dv +#define glUniformMatrix4fv gl3wProcs.gl.UniformMatrix4fv +#define glUniformMatrix4x2dv gl3wProcs.gl.UniformMatrix4x2dv +#define glUniformMatrix4x2fv gl3wProcs.gl.UniformMatrix4x2fv +#define glUniformMatrix4x3dv gl3wProcs.gl.UniformMatrix4x3dv +#define glUniformMatrix4x3fv gl3wProcs.gl.UniformMatrix4x3fv +#define glUniformSubroutinesuiv gl3wProcs.gl.UniformSubroutinesuiv +#define glUnmapBuffer gl3wProcs.gl.UnmapBuffer +#define glUnmapNamedBuffer gl3wProcs.gl.UnmapNamedBuffer +#define glUseProgram gl3wProcs.gl.UseProgram +#define glUseProgramStages gl3wProcs.gl.UseProgramStages +#define glValidateProgram gl3wProcs.gl.ValidateProgram +#define glValidateProgramPipeline gl3wProcs.gl.ValidateProgramPipeline +#define glVertexArrayAttribBinding gl3wProcs.gl.VertexArrayAttribBinding +#define glVertexArrayAttribFormat gl3wProcs.gl.VertexArrayAttribFormat +#define glVertexArrayAttribIFormat gl3wProcs.gl.VertexArrayAttribIFormat +#define glVertexArrayAttribLFormat gl3wProcs.gl.VertexArrayAttribLFormat +#define glVertexArrayBindingDivisor gl3wProcs.gl.VertexArrayBindingDivisor +#define glVertexArrayElementBuffer gl3wProcs.gl.VertexArrayElementBuffer +#define glVertexArrayVertexBuffer gl3wProcs.gl.VertexArrayVertexBuffer +#define glVertexArrayVertexBuffers gl3wProcs.gl.VertexArrayVertexBuffers +#define glVertexAttrib1d gl3wProcs.gl.VertexAttrib1d +#define glVertexAttrib1dv gl3wProcs.gl.VertexAttrib1dv +#define glVertexAttrib1f gl3wProcs.gl.VertexAttrib1f +#define glVertexAttrib1fv gl3wProcs.gl.VertexAttrib1fv +#define glVertexAttrib1s gl3wProcs.gl.VertexAttrib1s +#define glVertexAttrib1sv gl3wProcs.gl.VertexAttrib1sv +#define glVertexAttrib2d gl3wProcs.gl.VertexAttrib2d +#define glVertexAttrib2dv gl3wProcs.gl.VertexAttrib2dv +#define glVertexAttrib2f gl3wProcs.gl.VertexAttrib2f +#define glVertexAttrib2fv gl3wProcs.gl.VertexAttrib2fv +#define glVertexAttrib2s gl3wProcs.gl.VertexAttrib2s +#define glVertexAttrib2sv gl3wProcs.gl.VertexAttrib2sv +#define glVertexAttrib3d gl3wProcs.gl.VertexAttrib3d +#define glVertexAttrib3dv gl3wProcs.gl.VertexAttrib3dv +#define glVertexAttrib3f gl3wProcs.gl.VertexAttrib3f +#define glVertexAttrib3fv gl3wProcs.gl.VertexAttrib3fv +#define glVertexAttrib3s gl3wProcs.gl.VertexAttrib3s +#define glVertexAttrib3sv gl3wProcs.gl.VertexAttrib3sv +#define glVertexAttrib4Nbv gl3wProcs.gl.VertexAttrib4Nbv +#define glVertexAttrib4Niv gl3wProcs.gl.VertexAttrib4Niv +#define glVertexAttrib4Nsv gl3wProcs.gl.VertexAttrib4Nsv +#define glVertexAttrib4Nub gl3wProcs.gl.VertexAttrib4Nub +#define glVertexAttrib4Nubv gl3wProcs.gl.VertexAttrib4Nubv +#define glVertexAttrib4Nuiv gl3wProcs.gl.VertexAttrib4Nuiv +#define glVertexAttrib4Nusv gl3wProcs.gl.VertexAttrib4Nusv +#define glVertexAttrib4bv gl3wProcs.gl.VertexAttrib4bv +#define glVertexAttrib4d gl3wProcs.gl.VertexAttrib4d +#define glVertexAttrib4dv gl3wProcs.gl.VertexAttrib4dv +#define glVertexAttrib4f gl3wProcs.gl.VertexAttrib4f +#define glVertexAttrib4fv gl3wProcs.gl.VertexAttrib4fv +#define glVertexAttrib4iv gl3wProcs.gl.VertexAttrib4iv +#define glVertexAttrib4s gl3wProcs.gl.VertexAttrib4s +#define glVertexAttrib4sv gl3wProcs.gl.VertexAttrib4sv +#define glVertexAttrib4ubv gl3wProcs.gl.VertexAttrib4ubv +#define glVertexAttrib4uiv gl3wProcs.gl.VertexAttrib4uiv +#define glVertexAttrib4usv gl3wProcs.gl.VertexAttrib4usv +#define glVertexAttribBinding gl3wProcs.gl.VertexAttribBinding +#define glVertexAttribDivisor gl3wProcs.gl.VertexAttribDivisor +#define glVertexAttribFormat gl3wProcs.gl.VertexAttribFormat +#define glVertexAttribI1i gl3wProcs.gl.VertexAttribI1i +#define glVertexAttribI1iv gl3wProcs.gl.VertexAttribI1iv +#define glVertexAttribI1ui gl3wProcs.gl.VertexAttribI1ui +#define glVertexAttribI1uiv gl3wProcs.gl.VertexAttribI1uiv +#define glVertexAttribI2i gl3wProcs.gl.VertexAttribI2i +#define glVertexAttribI2iv gl3wProcs.gl.VertexAttribI2iv +#define glVertexAttribI2ui gl3wProcs.gl.VertexAttribI2ui +#define glVertexAttribI2uiv gl3wProcs.gl.VertexAttribI2uiv +#define glVertexAttribI3i gl3wProcs.gl.VertexAttribI3i +#define glVertexAttribI3iv gl3wProcs.gl.VertexAttribI3iv +#define glVertexAttribI3ui gl3wProcs.gl.VertexAttribI3ui +#define glVertexAttribI3uiv gl3wProcs.gl.VertexAttribI3uiv +#define glVertexAttribI4bv gl3wProcs.gl.VertexAttribI4bv +#define glVertexAttribI4i gl3wProcs.gl.VertexAttribI4i +#define glVertexAttribI4iv gl3wProcs.gl.VertexAttribI4iv +#define glVertexAttribI4sv gl3wProcs.gl.VertexAttribI4sv +#define glVertexAttribI4ubv gl3wProcs.gl.VertexAttribI4ubv +#define glVertexAttribI4ui gl3wProcs.gl.VertexAttribI4ui +#define glVertexAttribI4uiv gl3wProcs.gl.VertexAttribI4uiv +#define glVertexAttribI4usv gl3wProcs.gl.VertexAttribI4usv +#define glVertexAttribIFormat gl3wProcs.gl.VertexAttribIFormat +#define glVertexAttribIPointer gl3wProcs.gl.VertexAttribIPointer +#define glVertexAttribL1d gl3wProcs.gl.VertexAttribL1d +#define glVertexAttribL1dv gl3wProcs.gl.VertexAttribL1dv +#define glVertexAttribL2d gl3wProcs.gl.VertexAttribL2d +#define glVertexAttribL2dv gl3wProcs.gl.VertexAttribL2dv +#define glVertexAttribL3d gl3wProcs.gl.VertexAttribL3d +#define glVertexAttribL3dv gl3wProcs.gl.VertexAttribL3dv +#define glVertexAttribL4d gl3wProcs.gl.VertexAttribL4d +#define glVertexAttribL4dv gl3wProcs.gl.VertexAttribL4dv +#define glVertexAttribLFormat gl3wProcs.gl.VertexAttribLFormat +#define glVertexAttribLPointer gl3wProcs.gl.VertexAttribLPointer +#define glVertexAttribP1ui gl3wProcs.gl.VertexAttribP1ui +#define glVertexAttribP1uiv gl3wProcs.gl.VertexAttribP1uiv +#define glVertexAttribP2ui gl3wProcs.gl.VertexAttribP2ui +#define glVertexAttribP2uiv gl3wProcs.gl.VertexAttribP2uiv +#define glVertexAttribP3ui gl3wProcs.gl.VertexAttribP3ui +#define glVertexAttribP3uiv gl3wProcs.gl.VertexAttribP3uiv +#define glVertexAttribP4ui gl3wProcs.gl.VertexAttribP4ui +#define glVertexAttribP4uiv gl3wProcs.gl.VertexAttribP4uiv +#define glVertexAttribPointer gl3wProcs.gl.VertexAttribPointer +#define glVertexBindingDivisor gl3wProcs.gl.VertexBindingDivisor +#define glViewport gl3wProcs.gl.Viewport +#define glViewportArrayv gl3wProcs.gl.ViewportArrayv +#define glViewportIndexedf gl3wProcs.gl.ViewportIndexedf +#define glViewportIndexedfv gl3wProcs.gl.ViewportIndexedfv +#define glWaitSync gl3wProcs.gl.WaitSync + +#ifdef __cplusplus +} +#endif + +#endif diff --git a/TSE_GlfwOpenGlImpl/include/GL/glcorearb.h b/TSE_GlfwOpenGlImpl/include/GL/glcorearb.h new file mode 100644 index 0000000..9918457 --- /dev/null +++ b/TSE_GlfwOpenGlImpl/include/GL/glcorearb.h @@ -0,0 +1,5997 @@ +#ifndef __gl_glcorearb_h_ +#define __gl_glcorearb_h_ 1 + +#ifdef __cplusplus +extern "C" { +#endif + +/* +** Copyright 2013-2020 The Khronos Group Inc. +** SPDX-License-Identifier: MIT +** +** This header is generated from the Khronos OpenGL / OpenGL ES XML +** API Registry. The current version of the Registry, generator scripts +** used to make the header, and the header can be found at +** https://github.com/KhronosGroup/OpenGL-Registry +*/ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#ifndef WIN32_LEAN_AND_MEAN +#define WIN32_LEAN_AND_MEAN 1 +#endif +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +/* glcorearb.h is for use with OpenGL core profile implementations. +** It should should be placed in the same directory as gl.h and +** included as . +** +** glcorearb.h includes only APIs in the latest OpenGL core profile +** implementation together with APIs in newer ARB extensions which +** can be supported by the core profile. It does not, and never will +** include functionality removed from the core profile, such as +** fixed-function vertex and fragment processing. +** +** Do not #include both and either of or +** in the same source file. +*/ + +/* Generated C header for: + * API: gl + * Profile: core + * Versions considered: .* + * Versions emitted: .* + * Default extensions included: glcore + * Additional extensions included: _nomatch_^ + * Extensions removed: _nomatch_^ + */ + +#ifndef GL_VERSION_1_0 +#define GL_VERSION_1_0 1 +typedef void GLvoid; +typedef unsigned int GLenum; +#include +typedef khronos_float_t GLfloat; +typedef int GLint; +typedef int GLsizei; +typedef unsigned int GLbitfield; +typedef double GLdouble; +typedef unsigned int GLuint; +typedef unsigned char GLboolean; +typedef khronos_uint8_t GLubyte; +#define GL_DEPTH_BUFFER_BIT 0x00000100 +#define GL_STENCIL_BUFFER_BIT 0x00000400 +#define GL_COLOR_BUFFER_BIT 0x00004000 +#define GL_FALSE 0 +#define GL_TRUE 1 +#define GL_POINTS 0x0000 +#define GL_LINES 0x0001 +#define GL_LINE_LOOP 0x0002 +#define GL_LINE_STRIP 0x0003 +#define GL_TRIANGLES 0x0004 +#define GL_TRIANGLE_STRIP 0x0005 +#define GL_TRIANGLE_FAN 0x0006 +#define GL_QUADS 0x0007 +#define GL_NEVER 0x0200 +#define GL_LESS 0x0201 +#define GL_EQUAL 0x0202 +#define GL_LEQUAL 0x0203 +#define GL_GREATER 0x0204 +#define GL_NOTEQUAL 0x0205 +#define GL_GEQUAL 0x0206 +#define GL_ALWAYS 0x0207 +#define GL_ZERO 0 +#define GL_ONE 1 +#define GL_SRC_COLOR 0x0300 +#define GL_ONE_MINUS_SRC_COLOR 0x0301 +#define GL_SRC_ALPHA 0x0302 +#define GL_ONE_MINUS_SRC_ALPHA 0x0303 +#define GL_DST_ALPHA 0x0304 +#define GL_ONE_MINUS_DST_ALPHA 0x0305 +#define GL_DST_COLOR 0x0306 +#define GL_ONE_MINUS_DST_COLOR 0x0307 +#define GL_SRC_ALPHA_SATURATE 0x0308 +#define GL_NONE 0 +#define GL_FRONT_LEFT 0x0400 +#define GL_FRONT_RIGHT 0x0401 +#define GL_BACK_LEFT 0x0402 +#define GL_BACK_RIGHT 0x0403 +#define GL_FRONT 0x0404 +#define GL_BACK 0x0405 +#define GL_LEFT 0x0406 +#define GL_RIGHT 0x0407 +#define GL_FRONT_AND_BACK 0x0408 +#define GL_NO_ERROR 0 +#define GL_INVALID_ENUM 0x0500 +#define GL_INVALID_VALUE 0x0501 +#define GL_INVALID_OPERATION 0x0502 +#define GL_OUT_OF_MEMORY 0x0505 +#define GL_CW 0x0900 +#define GL_CCW 0x0901 +#define GL_POINT_SIZE 0x0B11 +#define GL_POINT_SIZE_RANGE 0x0B12 +#define GL_POINT_SIZE_GRANULARITY 0x0B13 +#define GL_LINE_SMOOTH 0x0B20 +#define GL_LINE_WIDTH 0x0B21 +#define GL_LINE_WIDTH_RANGE 0x0B22 +#define GL_LINE_WIDTH_GRANULARITY 0x0B23 +#define GL_POLYGON_MODE 0x0B40 +#define GL_POLYGON_SMOOTH 0x0B41 +#define GL_CULL_FACE 0x0B44 +#define GL_CULL_FACE_MODE 0x0B45 +#define GL_FRONT_FACE 0x0B46 +#define GL_DEPTH_RANGE 0x0B70 +#define GL_DEPTH_TEST 0x0B71 +#define GL_DEPTH_WRITEMASK 0x0B72 +#define GL_DEPTH_CLEAR_VALUE 0x0B73 +#define GL_DEPTH_FUNC 0x0B74 +#define GL_STENCIL_TEST 0x0B90 +#define GL_STENCIL_CLEAR_VALUE 0x0B91 +#define GL_STENCIL_FUNC 0x0B92 +#define GL_STENCIL_VALUE_MASK 0x0B93 +#define GL_STENCIL_FAIL 0x0B94 +#define GL_STENCIL_PASS_DEPTH_FAIL 0x0B95 +#define GL_STENCIL_PASS_DEPTH_PASS 0x0B96 +#define GL_STENCIL_REF 0x0B97 +#define GL_STENCIL_WRITEMASK 0x0B98 +#define GL_VIEWPORT 0x0BA2 +#define GL_DITHER 0x0BD0 +#define GL_BLEND_DST 0x0BE0 +#define GL_BLEND_SRC 0x0BE1 +#define GL_BLEND 0x0BE2 +#define GL_LOGIC_OP_MODE 0x0BF0 +#define GL_DRAW_BUFFER 0x0C01 +#define GL_READ_BUFFER 0x0C02 +#define GL_SCISSOR_BOX 0x0C10 +#define GL_SCISSOR_TEST 0x0C11 +#define GL_COLOR_CLEAR_VALUE 0x0C22 +#define GL_COLOR_WRITEMASK 0x0C23 +#define GL_DOUBLEBUFFER 0x0C32 +#define GL_STEREO 0x0C33 +#define GL_LINE_SMOOTH_HINT 0x0C52 +#define GL_POLYGON_SMOOTH_HINT 0x0C53 +#define GL_UNPACK_SWAP_BYTES 0x0CF0 +#define GL_UNPACK_LSB_FIRST 0x0CF1 +#define GL_UNPACK_ROW_LENGTH 0x0CF2 +#define GL_UNPACK_SKIP_ROWS 0x0CF3 +#define GL_UNPACK_SKIP_PIXELS 0x0CF4 +#define GL_UNPACK_ALIGNMENT 0x0CF5 +#define GL_PACK_SWAP_BYTES 0x0D00 +#define GL_PACK_LSB_FIRST 0x0D01 +#define GL_PACK_ROW_LENGTH 0x0D02 +#define GL_PACK_SKIP_ROWS 0x0D03 +#define GL_PACK_SKIP_PIXELS 0x0D04 +#define GL_PACK_ALIGNMENT 0x0D05 +#define GL_MAX_TEXTURE_SIZE 0x0D33 +#define GL_MAX_VIEWPORT_DIMS 0x0D3A +#define GL_SUBPIXEL_BITS 0x0D50 +#define GL_TEXTURE_1D 0x0DE0 +#define GL_TEXTURE_2D 0x0DE1 +#define GL_TEXTURE_WIDTH 0x1000 +#define GL_TEXTURE_HEIGHT 0x1001 +#define GL_TEXTURE_BORDER_COLOR 0x1004 +#define GL_DONT_CARE 0x1100 +#define GL_FASTEST 0x1101 +#define GL_NICEST 0x1102 +#define GL_BYTE 0x1400 +#define GL_UNSIGNED_BYTE 0x1401 +#define GL_SHORT 0x1402 +#define GL_UNSIGNED_SHORT 0x1403 +#define GL_INT 0x1404 +#define GL_UNSIGNED_INT 0x1405 +#define GL_FLOAT 0x1406 +#define GL_STACK_OVERFLOW 0x0503 +#define GL_STACK_UNDERFLOW 0x0504 +#define GL_CLEAR 0x1500 +#define GL_AND 0x1501 +#define GL_AND_REVERSE 0x1502 +#define GL_COPY 0x1503 +#define GL_AND_INVERTED 0x1504 +#define GL_NOOP 0x1505 +#define GL_XOR 0x1506 +#define GL_OR 0x1507 +#define GL_NOR 0x1508 +#define GL_EQUIV 0x1509 +#define GL_INVERT 0x150A +#define GL_OR_REVERSE 0x150B +#define GL_COPY_INVERTED 0x150C +#define GL_OR_INVERTED 0x150D +#define GL_NAND 0x150E +#define GL_SET 0x150F +#define GL_TEXTURE 0x1702 +#define GL_COLOR 0x1800 +#define GL_DEPTH 0x1801 +#define GL_STENCIL 0x1802 +#define GL_STENCIL_INDEX 0x1901 +#define GL_DEPTH_COMPONENT 0x1902 +#define GL_RED 0x1903 +#define GL_GREEN 0x1904 +#define GL_BLUE 0x1905 +#define GL_ALPHA 0x1906 +#define GL_RGB 0x1907 +#define GL_RGBA 0x1908 +#define GL_POINT 0x1B00 +#define GL_LINE 0x1B01 +#define GL_FILL 0x1B02 +#define GL_KEEP 0x1E00 +#define GL_REPLACE 0x1E01 +#define GL_INCR 0x1E02 +#define GL_DECR 0x1E03 +#define GL_VENDOR 0x1F00 +#define GL_RENDERER 0x1F01 +#define GL_VERSION 0x1F02 +#define GL_EXTENSIONS 0x1F03 +#define GL_NEAREST 0x2600 +#define GL_LINEAR 0x2601 +#define GL_NEAREST_MIPMAP_NEAREST 0x2700 +#define GL_LINEAR_MIPMAP_NEAREST 0x2701 +#define GL_NEAREST_MIPMAP_LINEAR 0x2702 +#define GL_LINEAR_MIPMAP_LINEAR 0x2703 +#define GL_TEXTURE_MAG_FILTER 0x2800 +#define GL_TEXTURE_MIN_FILTER 0x2801 +#define GL_TEXTURE_WRAP_S 0x2802 +#define GL_TEXTURE_WRAP_T 0x2803 +#define GL_REPEAT 0x2901 +typedef void (APIENTRYP PFNGLCULLFACEPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLFRONTFACEPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLHINTPROC) (GLenum target, GLenum mode); +typedef void (APIENTRYP PFNGLLINEWIDTHPROC) (GLfloat width); +typedef void (APIENTRYP PFNGLPOINTSIZEPROC) (GLfloat size); +typedef void (APIENTRYP PFNGLPOLYGONMODEPROC) (GLenum face, GLenum mode); +typedef void (APIENTRYP PFNGLSCISSORPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXIMAGE1DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXIMAGE2DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLDRAWBUFFERPROC) (GLenum buf); +typedef void (APIENTRYP PFNGLCLEARPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLCLEARCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (APIENTRYP PFNGLCLEARSTENCILPROC) (GLint s); +typedef void (APIENTRYP PFNGLCLEARDEPTHPROC) (GLdouble depth); +typedef void (APIENTRYP PFNGLSTENCILMASKPROC) (GLuint mask); +typedef void (APIENTRYP PFNGLCOLORMASKPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +typedef void (APIENTRYP PFNGLDEPTHMASKPROC) (GLboolean flag); +typedef void (APIENTRYP PFNGLDISABLEPROC) (GLenum cap); +typedef void (APIENTRYP PFNGLENABLEPROC) (GLenum cap); +typedef void (APIENTRYP PFNGLFINISHPROC) (void); +typedef void (APIENTRYP PFNGLFLUSHPROC) (void); +typedef void (APIENTRYP PFNGLBLENDFUNCPROC) (GLenum sfactor, GLenum dfactor); +typedef void (APIENTRYP PFNGLLOGICOPPROC) (GLenum opcode); +typedef void (APIENTRYP PFNGLSTENCILFUNCPROC) (GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILOPPROC) (GLenum fail, GLenum zfail, GLenum zpass); +typedef void (APIENTRYP PFNGLDEPTHFUNCPROC) (GLenum func); +typedef void (APIENTRYP PFNGLPIXELSTOREFPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELSTOREIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLREADBUFFERPROC) (GLenum src); +typedef void (APIENTRYP PFNGLREADPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETBOOLEANVPROC) (GLenum pname, GLboolean *data); +typedef void (APIENTRYP PFNGLGETDOUBLEVPROC) (GLenum pname, GLdouble *data); +typedef GLenum (APIENTRYP PFNGLGETERRORPROC) (void); +typedef void (APIENTRYP PFNGLGETFLOATVPROC) (GLenum pname, GLfloat *data); +typedef void (APIENTRYP PFNGLGETINTEGERVPROC) (GLenum pname, GLint *data); +typedef const GLubyte *(APIENTRYP PFNGLGETSTRINGPROC) (GLenum name); +typedef void (APIENTRYP PFNGLGETTEXIMAGEPROC) (GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXLEVELPARAMETERFVPROC) (GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXLEVELPARAMETERIVPROC) (GLenum target, GLint level, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISENABLEDPROC) (GLenum cap); +typedef void (APIENTRYP PFNGLDEPTHRANGEPROC) (GLdouble n, GLdouble f); +typedef void (APIENTRYP PFNGLVIEWPORTPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCullFace (GLenum mode); +GLAPI void APIENTRY glFrontFace (GLenum mode); +GLAPI void APIENTRY glHint (GLenum target, GLenum mode); +GLAPI void APIENTRY glLineWidth (GLfloat width); +GLAPI void APIENTRY glPointSize (GLfloat size); +GLAPI void APIENTRY glPolygonMode (GLenum face, GLenum mode); +GLAPI void APIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexImage1D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glDrawBuffer (GLenum buf); +GLAPI void APIENTRY glClear (GLbitfield mask); +GLAPI void APIENTRY glClearColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GLAPI void APIENTRY glClearStencil (GLint s); +GLAPI void APIENTRY glClearDepth (GLdouble depth); +GLAPI void APIENTRY glStencilMask (GLuint mask); +GLAPI void APIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +GLAPI void APIENTRY glDepthMask (GLboolean flag); +GLAPI void APIENTRY glDisable (GLenum cap); +GLAPI void APIENTRY glEnable (GLenum cap); +GLAPI void APIENTRY glFinish (void); +GLAPI void APIENTRY glFlush (void); +GLAPI void APIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor); +GLAPI void APIENTRY glLogicOp (GLenum opcode); +GLAPI void APIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass); +GLAPI void APIENTRY glDepthFunc (GLenum func); +GLAPI void APIENTRY glPixelStoref (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPixelStorei (GLenum pname, GLint param); +GLAPI void APIENTRY glReadBuffer (GLenum src); +GLAPI void APIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetBooleanv (GLenum pname, GLboolean *data); +GLAPI void APIENTRY glGetDoublev (GLenum pname, GLdouble *data); +GLAPI GLenum APIENTRY glGetError (void); +GLAPI void APIENTRY glGetFloatv (GLenum pname, GLfloat *data); +GLAPI void APIENTRY glGetIntegerv (GLenum pname, GLint *data); +GLAPI const GLubyte *APIENTRY glGetString (GLenum name); +GLAPI void APIENTRY glGetTexImage (GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexLevelParameterfv (GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTexLevelParameteriv (GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsEnabled (GLenum cap); +GLAPI void APIENTRY glDepthRange (GLdouble n, GLdouble f); +GLAPI void APIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height); +#endif +#endif /* GL_VERSION_1_0 */ + +#ifndef GL_VERSION_1_1 +#define GL_VERSION_1_1 1 +typedef khronos_float_t GLclampf; +typedef double GLclampd; +#define GL_COLOR_LOGIC_OP 0x0BF2 +#define GL_POLYGON_OFFSET_UNITS 0x2A00 +#define GL_POLYGON_OFFSET_POINT 0x2A01 +#define GL_POLYGON_OFFSET_LINE 0x2A02 +#define GL_POLYGON_OFFSET_FILL 0x8037 +#define GL_POLYGON_OFFSET_FACTOR 0x8038 +#define GL_TEXTURE_BINDING_1D 0x8068 +#define GL_TEXTURE_BINDING_2D 0x8069 +#define GL_TEXTURE_INTERNAL_FORMAT 0x1003 +#define GL_TEXTURE_RED_SIZE 0x805C +#define GL_TEXTURE_GREEN_SIZE 0x805D +#define GL_TEXTURE_BLUE_SIZE 0x805E +#define GL_TEXTURE_ALPHA_SIZE 0x805F +#define GL_DOUBLE 0x140A +#define GL_PROXY_TEXTURE_1D 0x8063 +#define GL_PROXY_TEXTURE_2D 0x8064 +#define GL_R3_G3_B2 0x2A10 +#define GL_RGB4 0x804F +#define GL_RGB5 0x8050 +#define GL_RGB8 0x8051 +#define GL_RGB10 0x8052 +#define GL_RGB12 0x8053 +#define GL_RGB16 0x8054 +#define GL_RGBA2 0x8055 +#define GL_RGBA4 0x8056 +#define GL_RGB5_A1 0x8057 +#define GL_RGBA8 0x8058 +#define GL_RGB10_A2 0x8059 +#define GL_RGBA12 0x805A +#define GL_RGBA16 0x805B +#define GL_VERTEX_ARRAY 0x8074 +typedef void (APIENTRYP PFNGLDRAWARRAYSPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWELEMENTSPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices); +typedef void (APIENTRYP PFNGLGETPOINTERVPROC) (GLenum pname, void **params); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETPROC) (GLfloat factor, GLfloat units); +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLBINDTEXTUREPROC) (GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLDELETETEXTURESPROC) (GLsizei n, const GLuint *textures); +typedef void (APIENTRYP PFNGLGENTEXTURESPROC) (GLsizei n, GLuint *textures); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREPROC) (GLuint texture); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count); +GLAPI void APIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const void *indices); +GLAPI void APIENTRY glGetPointerv (GLenum pname, void **params); +GLAPI void APIENTRY glPolygonOffset (GLfloat factor, GLfloat units); +GLAPI void APIENTRY glCopyTexImage1D (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glBindTexture (GLenum target, GLuint texture); +GLAPI void APIENTRY glDeleteTextures (GLsizei n, const GLuint *textures); +GLAPI void APIENTRY glGenTextures (GLsizei n, GLuint *textures); +GLAPI GLboolean APIENTRY glIsTexture (GLuint texture); +#endif +#endif /* GL_VERSION_1_1 */ + +#ifndef GL_VERSION_1_2 +#define GL_VERSION_1_2 1 +#define GL_UNSIGNED_BYTE_3_3_2 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2 0x8036 +#define GL_TEXTURE_BINDING_3D 0x806A +#define GL_PACK_SKIP_IMAGES 0x806B +#define GL_PACK_IMAGE_HEIGHT 0x806C +#define GL_UNPACK_SKIP_IMAGES 0x806D +#define GL_UNPACK_IMAGE_HEIGHT 0x806E +#define GL_TEXTURE_3D 0x806F +#define GL_PROXY_TEXTURE_3D 0x8070 +#define GL_TEXTURE_DEPTH 0x8071 +#define GL_TEXTURE_WRAP_R 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE 0x8073 +#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 +#define GL_UNSIGNED_SHORT_5_6_5 0x8363 +#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 +#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 +#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 +#define GL_BGR 0x80E0 +#define GL_BGRA 0x80E1 +#define GL_MAX_ELEMENTS_VERTICES 0x80E8 +#define GL_MAX_ELEMENTS_INDICES 0x80E9 +#define GL_CLAMP_TO_EDGE 0x812F +#define GL_TEXTURE_MIN_LOD 0x813A +#define GL_TEXTURE_MAX_LOD 0x813B +#define GL_TEXTURE_BASE_LEVEL 0x813C +#define GL_TEXTURE_MAX_LEVEL 0x813D +#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 +#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 +#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 +#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 +#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices); +GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif +#endif /* GL_VERSION_1_2 */ + +#ifndef GL_VERSION_1_3 +#define GL_VERSION_1_3 1 +#define GL_TEXTURE0 0x84C0 +#define GL_TEXTURE1 0x84C1 +#define GL_TEXTURE2 0x84C2 +#define GL_TEXTURE3 0x84C3 +#define GL_TEXTURE4 0x84C4 +#define GL_TEXTURE5 0x84C5 +#define GL_TEXTURE6 0x84C6 +#define GL_TEXTURE7 0x84C7 +#define GL_TEXTURE8 0x84C8 +#define GL_TEXTURE9 0x84C9 +#define GL_TEXTURE10 0x84CA +#define GL_TEXTURE11 0x84CB +#define GL_TEXTURE12 0x84CC +#define GL_TEXTURE13 0x84CD +#define GL_TEXTURE14 0x84CE +#define GL_TEXTURE15 0x84CF +#define GL_TEXTURE16 0x84D0 +#define GL_TEXTURE17 0x84D1 +#define GL_TEXTURE18 0x84D2 +#define GL_TEXTURE19 0x84D3 +#define GL_TEXTURE20 0x84D4 +#define GL_TEXTURE21 0x84D5 +#define GL_TEXTURE22 0x84D6 +#define GL_TEXTURE23 0x84D7 +#define GL_TEXTURE24 0x84D8 +#define GL_TEXTURE25 0x84D9 +#define GL_TEXTURE26 0x84DA +#define GL_TEXTURE27 0x84DB +#define GL_TEXTURE28 0x84DC +#define GL_TEXTURE29 0x84DD +#define GL_TEXTURE30 0x84DE +#define GL_TEXTURE31 0x84DF +#define GL_ACTIVE_TEXTURE 0x84E0 +#define GL_MULTISAMPLE 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE 0x809F +#define GL_SAMPLE_COVERAGE 0x80A0 +#define GL_SAMPLE_BUFFERS 0x80A8 +#define GL_SAMPLES 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT 0x80AB +#define GL_TEXTURE_CUBE_MAP 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C +#define GL_COMPRESSED_RGB 0x84ED +#define GL_COMPRESSED_RGBA 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 +#define GL_TEXTURE_COMPRESSED 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 +#define GL_CLAMP_TO_BORDER 0x812D +typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLfloat value, GLboolean invert); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTexture (GLenum texture); +GLAPI void APIENTRY glSampleCoverage (GLfloat value, GLboolean invert); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, void *img); +#endif +#endif /* GL_VERSION_1_3 */ + +#ifndef GL_VERSION_1_4 +#define GL_VERSION_1_4 1 +#define GL_BLEND_DST_RGB 0x80C8 +#define GL_BLEND_SRC_RGB 0x80C9 +#define GL_BLEND_DST_ALPHA 0x80CA +#define GL_BLEND_SRC_ALPHA 0x80CB +#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 +#define GL_DEPTH_COMPONENT16 0x81A5 +#define GL_DEPTH_COMPONENT24 0x81A6 +#define GL_DEPTH_COMPONENT32 0x81A7 +#define GL_MIRRORED_REPEAT 0x8370 +#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD +#define GL_TEXTURE_LOD_BIAS 0x8501 +#define GL_INCR_WRAP 0x8507 +#define GL_DECR_WRAP 0x8508 +#define GL_TEXTURE_DEPTH_SIZE 0x884A +#define GL_TEXTURE_COMPARE_MODE 0x884C +#define GL_TEXTURE_COMPARE_FUNC 0x884D +#define GL_BLEND_COLOR 0x8005 +#define GL_BLEND_EQUATION 0x8009 +#define GL_CONSTANT_COLOR 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 +#define GL_CONSTANT_ALPHA 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_FUNC_SUBTRACT 0x800A +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +GLAPI void APIENTRY glMultiDrawArrays (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); +GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); +GLAPI void APIENTRY glPointParameterf (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfv (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glPointParameteri (GLenum pname, GLint param); +GLAPI void APIENTRY glPointParameteriv (GLenum pname, const GLint *params); +GLAPI void APIENTRY glBlendColor (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha); +GLAPI void APIENTRY glBlendEquation (GLenum mode); +#endif +#endif /* GL_VERSION_1_4 */ + +#ifndef GL_VERSION_1_5 +#define GL_VERSION_1_5 1 +typedef khronos_ssize_t GLsizeiptr; +typedef khronos_intptr_t GLintptr; +#define GL_BUFFER_SIZE 0x8764 +#define GL_BUFFER_USAGE 0x8765 +#define GL_QUERY_COUNTER_BITS 0x8864 +#define GL_CURRENT_QUERY 0x8865 +#define GL_QUERY_RESULT 0x8866 +#define GL_QUERY_RESULT_AVAILABLE 0x8867 +#define GL_ARRAY_BUFFER 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER 0x8893 +#define GL_ARRAY_BUFFER_BINDING 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F +#define GL_READ_ONLY 0x88B8 +#define GL_WRITE_ONLY 0x88B9 +#define GL_READ_WRITE 0x88BA +#define GL_BUFFER_ACCESS 0x88BB +#define GL_BUFFER_MAPPED 0x88BC +#define GL_BUFFER_MAP_POINTER 0x88BD +#define GL_STREAM_DRAW 0x88E0 +#define GL_STREAM_READ 0x88E1 +#define GL_STREAM_COPY 0x88E2 +#define GL_STATIC_DRAW 0x88E4 +#define GL_STATIC_READ 0x88E5 +#define GL_STATIC_COPY 0x88E6 +#define GL_DYNAMIC_DRAW 0x88E8 +#define GL_DYNAMIC_READ 0x88E9 +#define GL_DYNAMIC_COPY 0x88EA +#define GL_SAMPLES_PASSED 0x8914 +#define GL_SRC1_ALPHA 0x8589 +typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, void *data); +typedef void *(APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, void **params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueries (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteQueries (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsQuery (GLuint id); +GLAPI void APIENTRY glBeginQuery (GLenum target, GLuint id); +GLAPI void APIENTRY glEndQuery (GLenum target); +GLAPI void APIENTRY glGetQueryiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectiv (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectuiv (GLuint id, GLenum pname, GLuint *params); +GLAPI void APIENTRY glBindBuffer (GLenum target, GLuint buffer); +GLAPI void APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); +GLAPI void APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); +GLAPI GLboolean APIENTRY glIsBuffer (GLuint buffer); +GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void *APIENTRY glMapBuffer (GLenum target, GLenum access); +GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum target); +GLAPI void APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, void **params); +#endif +#endif /* GL_VERSION_1_5 */ + +#ifndef GL_VERSION_2_0 +#define GL_VERSION_2_0 1 +typedef char GLchar; +typedef khronos_int16_t GLshort; +typedef khronos_int8_t GLbyte; +typedef khronos_uint16_t GLushort; +#define GL_BLEND_EQUATION_RGB 0x8009 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB 0x8626 +#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 +#define GL_STENCIL_BACK_FUNC 0x8800 +#define GL_STENCIL_BACK_FAIL 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 +#define GL_MAX_DRAW_BUFFERS 0x8824 +#define GL_DRAW_BUFFER0 0x8825 +#define GL_DRAW_BUFFER1 0x8826 +#define GL_DRAW_BUFFER2 0x8827 +#define GL_DRAW_BUFFER3 0x8828 +#define GL_DRAW_BUFFER4 0x8829 +#define GL_DRAW_BUFFER5 0x882A +#define GL_DRAW_BUFFER6 0x882B +#define GL_DRAW_BUFFER7 0x882C +#define GL_DRAW_BUFFER8 0x882D +#define GL_DRAW_BUFFER9 0x882E +#define GL_DRAW_BUFFER10 0x882F +#define GL_DRAW_BUFFER11 0x8830 +#define GL_DRAW_BUFFER12 0x8831 +#define GL_DRAW_BUFFER13 0x8832 +#define GL_DRAW_BUFFER14 0x8833 +#define GL_DRAW_BUFFER15 0x8834 +#define GL_BLEND_EQUATION_ALPHA 0x883D +#define GL_MAX_VERTEX_ATTRIBS 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A +#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 +#define GL_FRAGMENT_SHADER 0x8B30 +#define GL_VERTEX_SHADER 0x8B31 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A +#define GL_MAX_VARYING_FLOATS 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D +#define GL_SHADER_TYPE 0x8B4F +#define GL_FLOAT_VEC2 0x8B50 +#define GL_FLOAT_VEC3 0x8B51 +#define GL_FLOAT_VEC4 0x8B52 +#define GL_INT_VEC2 0x8B53 +#define GL_INT_VEC3 0x8B54 +#define GL_INT_VEC4 0x8B55 +#define GL_BOOL 0x8B56 +#define GL_BOOL_VEC2 0x8B57 +#define GL_BOOL_VEC3 0x8B58 +#define GL_BOOL_VEC4 0x8B59 +#define GL_FLOAT_MAT2 0x8B5A +#define GL_FLOAT_MAT3 0x8B5B +#define GL_FLOAT_MAT4 0x8B5C +#define GL_SAMPLER_1D 0x8B5D +#define GL_SAMPLER_2D 0x8B5E +#define GL_SAMPLER_3D 0x8B5F +#define GL_SAMPLER_CUBE 0x8B60 +#define GL_SAMPLER_1D_SHADOW 0x8B61 +#define GL_SAMPLER_2D_SHADOW 0x8B62 +#define GL_DELETE_STATUS 0x8B80 +#define GL_COMPILE_STATUS 0x8B81 +#define GL_LINK_STATUS 0x8B82 +#define GL_VALIDATE_STATUS 0x8B83 +#define GL_INFO_LOG_LENGTH 0x8B84 +#define GL_ATTACHED_SHADERS 0x8B85 +#define GL_ACTIVE_UNIFORMS 0x8B86 +#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 +#define GL_SHADER_SOURCE_LENGTH 0x8B88 +#define GL_ACTIVE_ATTRIBUTES 0x8B89 +#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B +#define GL_SHADING_LANGUAGE_VERSION 0x8B8C +#define GL_CURRENT_PROGRAM 0x8B8D +#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 +#define GL_LOWER_LEFT 0x8CA1 +#define GL_UPPER_LEFT 0x8CA2 +#define GL_STENCIL_BACK_REF 0x8CA3 +#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 +#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum face, GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); +typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); +typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, void **pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); +typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glDrawBuffers (GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glStencilOpSeparate (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GLAPI void APIENTRY glStencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glStencilMaskSeparate (GLenum face, GLuint mask); +GLAPI void APIENTRY glAttachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glBindAttribLocation (GLuint program, GLuint index, const GLchar *name); +GLAPI void APIENTRY glCompileShader (GLuint shader); +GLAPI GLuint APIENTRY glCreateProgram (void); +GLAPI GLuint APIENTRY glCreateShader (GLenum type); +GLAPI void APIENTRY glDeleteProgram (GLuint program); +GLAPI void APIENTRY glDeleteShader (GLuint shader); +GLAPI void APIENTRY glDetachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glDisableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glEnableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glGetActiveAttrib (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetActiveUniform (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetAttachedShaders (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *shaders); +GLAPI GLint APIENTRY glGetAttribLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetProgramiv (GLuint program, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramInfoLog (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderiv (GLuint shader, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetShaderInfoLog (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderSource (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +GLAPI GLint APIENTRY glGetUniformLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetUniformfv (GLuint program, GLint location, GLfloat *params); +GLAPI void APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *params); +GLAPI void APIENTRY glGetVertexAttribdv (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, void **pointer); +GLAPI GLboolean APIENTRY glIsProgram (GLuint program); +GLAPI GLboolean APIENTRY glIsShader (GLuint shader); +GLAPI void APIENTRY glLinkProgram (GLuint program); +GLAPI void APIENTRY glShaderSource (GLuint shader, GLsizei count, const GLchar *const*string, const GLint *length); +GLAPI void APIENTRY glUseProgram (GLuint program); +GLAPI void APIENTRY glUniform1f (GLint location, GLfloat v0); +GLAPI void APIENTRY glUniform2f (GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glUniform3f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glUniform4f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glUniform1i (GLint location, GLint v0); +GLAPI void APIENTRY glUniform2i (GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glUniform3i (GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glUniform4i (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glUniform1fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform2fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform3fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform4fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform1iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform2iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform3iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform4iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glValidateProgram (GLuint program); +GLAPI void APIENTRY glVertexAttrib1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1f (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1s (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2f (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2s (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3f (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3s (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4Niv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nub (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttrib4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4f (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4s (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void *pointer); +#endif +#endif /* GL_VERSION_2_0 */ + +#ifndef GL_VERSION_2_1 +#define GL_VERSION_2_1 1 +#define GL_PIXEL_PACK_BUFFER 0x88EB +#define GL_PIXEL_UNPACK_BUFFER 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING 0x88EF +#define GL_FLOAT_MAT2x3 0x8B65 +#define GL_FLOAT_MAT2x4 0x8B66 +#define GL_FLOAT_MAT3x2 0x8B67 +#define GL_FLOAT_MAT3x4 0x8B68 +#define GL_FLOAT_MAT4x2 0x8B69 +#define GL_FLOAT_MAT4x3 0x8B6A +#define GL_SRGB 0x8C40 +#define GL_SRGB8 0x8C41 +#define GL_SRGB_ALPHA 0x8C42 +#define GL_SRGB8_ALPHA8 0x8C43 +#define GL_COMPRESSED_SRGB 0x8C48 +#define GL_COMPRESSED_SRGB_ALPHA 0x8C49 +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniformMatrix2x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix2x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#endif +#endif /* GL_VERSION_2_1 */ + +#ifndef GL_VERSION_3_0 +#define GL_VERSION_3_0 1 +typedef khronos_uint16_t GLhalf; +#define GL_COMPARE_REF_TO_TEXTURE 0x884E +#define GL_CLIP_DISTANCE0 0x3000 +#define GL_CLIP_DISTANCE1 0x3001 +#define GL_CLIP_DISTANCE2 0x3002 +#define GL_CLIP_DISTANCE3 0x3003 +#define GL_CLIP_DISTANCE4 0x3004 +#define GL_CLIP_DISTANCE5 0x3005 +#define GL_CLIP_DISTANCE6 0x3006 +#define GL_CLIP_DISTANCE7 0x3007 +#define GL_MAX_CLIP_DISTANCES 0x0D32 +#define GL_MAJOR_VERSION 0x821B +#define GL_MINOR_VERSION 0x821C +#define GL_NUM_EXTENSIONS 0x821D +#define GL_CONTEXT_FLAGS 0x821E +#define GL_COMPRESSED_RED 0x8225 +#define GL_COMPRESSED_RG 0x8226 +#define GL_CONTEXT_FLAG_FORWARD_COMPATIBLE_BIT 0x00000001 +#define GL_RGBA32F 0x8814 +#define GL_RGB32F 0x8815 +#define GL_RGBA16F 0x881A +#define GL_RGB16F 0x881B +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER 0x88FD +#define GL_MAX_ARRAY_TEXTURE_LAYERS 0x88FF +#define GL_MIN_PROGRAM_TEXEL_OFFSET 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET 0x8905 +#define GL_CLAMP_READ_COLOR 0x891C +#define GL_FIXED_ONLY 0x891D +#define GL_MAX_VARYING_COMPONENTS 0x8B4B +#define GL_TEXTURE_1D_ARRAY 0x8C18 +#define GL_PROXY_TEXTURE_1D_ARRAY 0x8C19 +#define GL_TEXTURE_2D_ARRAY 0x8C1A +#define GL_PROXY_TEXTURE_2D_ARRAY 0x8C1B +#define GL_TEXTURE_BINDING_1D_ARRAY 0x8C1C +#define GL_TEXTURE_BINDING_2D_ARRAY 0x8C1D +#define GL_R11F_G11F_B10F 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B +#define GL_RGB9_E5 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV 0x8C3E +#define GL_TEXTURE_SHARED_SIZE 0x8C3F +#define GL_TRANSFORM_FEEDBACK_VARYING_MAX_LENGTH 0x8C76 +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE 0x8C7F +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS 0x8C80 +#define GL_TRANSFORM_FEEDBACK_VARYINGS 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_START 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE 0x8C85 +#define GL_PRIMITIVES_GENERATED 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN 0x8C88 +#define GL_RASTERIZER_DISCARD 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS 0x8C8B +#define GL_INTERLEAVED_ATTRIBS 0x8C8C +#define GL_SEPARATE_ATTRIBS 0x8C8D +#define GL_TRANSFORM_FEEDBACK_BUFFER 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING 0x8C8F +#define GL_RGBA32UI 0x8D70 +#define GL_RGB32UI 0x8D71 +#define GL_RGBA16UI 0x8D76 +#define GL_RGB16UI 0x8D77 +#define GL_RGBA8UI 0x8D7C +#define GL_RGB8UI 0x8D7D +#define GL_RGBA32I 0x8D82 +#define GL_RGB32I 0x8D83 +#define GL_RGBA16I 0x8D88 +#define GL_RGB16I 0x8D89 +#define GL_RGBA8I 0x8D8E +#define GL_RGB8I 0x8D8F +#define GL_RED_INTEGER 0x8D94 +#define GL_GREEN_INTEGER 0x8D95 +#define GL_BLUE_INTEGER 0x8D96 +#define GL_RGB_INTEGER 0x8D98 +#define GL_RGBA_INTEGER 0x8D99 +#define GL_BGR_INTEGER 0x8D9A +#define GL_BGRA_INTEGER 0x8D9B +#define GL_SAMPLER_1D_ARRAY 0x8DC0 +#define GL_SAMPLER_2D_ARRAY 0x8DC1 +#define GL_SAMPLER_1D_ARRAY_SHADOW 0x8DC3 +#define GL_SAMPLER_2D_ARRAY_SHADOW 0x8DC4 +#define GL_SAMPLER_CUBE_SHADOW 0x8DC5 +#define GL_UNSIGNED_INT_VEC2 0x8DC6 +#define GL_UNSIGNED_INT_VEC3 0x8DC7 +#define GL_UNSIGNED_INT_VEC4 0x8DC8 +#define GL_INT_SAMPLER_1D 0x8DC9 +#define GL_INT_SAMPLER_2D 0x8DCA +#define GL_INT_SAMPLER_3D 0x8DCB +#define GL_INT_SAMPLER_CUBE 0x8DCC +#define GL_INT_SAMPLER_1D_ARRAY 0x8DCE +#define GL_INT_SAMPLER_2D_ARRAY 0x8DCF +#define GL_UNSIGNED_INT_SAMPLER_1D 0x8DD1 +#define GL_UNSIGNED_INT_SAMPLER_2D 0x8DD2 +#define GL_UNSIGNED_INT_SAMPLER_3D 0x8DD3 +#define GL_UNSIGNED_INT_SAMPLER_CUBE 0x8DD4 +#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY 0x8DD6 +#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY 0x8DD7 +#define GL_QUERY_WAIT 0x8E13 +#define GL_QUERY_NO_WAIT 0x8E14 +#define GL_QUERY_BY_REGION_WAIT 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT 0x8E16 +#define GL_BUFFER_ACCESS_FLAGS 0x911F +#define GL_BUFFER_MAP_LENGTH 0x9120 +#define GL_BUFFER_MAP_OFFSET 0x9121 +#define GL_DEPTH_COMPONENT32F 0x8CAC +#define GL_DEPTH32F_STENCIL8 0x8CAD +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV 0x8DAD +#define GL_INVALID_FRAMEBUFFER_OPERATION 0x0506 +#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING 0x8210 +#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE 0x8211 +#define GL_FRAMEBUFFER_ATTACHMENT_RED_SIZE 0x8212 +#define GL_FRAMEBUFFER_ATTACHMENT_GREEN_SIZE 0x8213 +#define GL_FRAMEBUFFER_ATTACHMENT_BLUE_SIZE 0x8214 +#define GL_FRAMEBUFFER_ATTACHMENT_ALPHA_SIZE 0x8215 +#define GL_FRAMEBUFFER_ATTACHMENT_DEPTH_SIZE 0x8216 +#define GL_FRAMEBUFFER_ATTACHMENT_STENCIL_SIZE 0x8217 +#define GL_FRAMEBUFFER_DEFAULT 0x8218 +#define GL_FRAMEBUFFER_UNDEFINED 0x8219 +#define GL_DEPTH_STENCIL_ATTACHMENT 0x821A +#define GL_MAX_RENDERBUFFER_SIZE 0x84E8 +#define GL_DEPTH_STENCIL 0x84F9 +#define GL_UNSIGNED_INT_24_8 0x84FA +#define GL_DEPTH24_STENCIL8 0x88F0 +#define GL_TEXTURE_STENCIL_SIZE 0x88F1 +#define GL_TEXTURE_RED_TYPE 0x8C10 +#define GL_TEXTURE_GREEN_TYPE 0x8C11 +#define GL_TEXTURE_BLUE_TYPE 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE 0x8C13 +#define GL_TEXTURE_DEPTH_TYPE 0x8C16 +#define GL_UNSIGNED_NORMALIZED 0x8C17 +#define GL_FRAMEBUFFER_BINDING 0x8CA6 +#define GL_DRAW_FRAMEBUFFER_BINDING 0x8CA6 +#define GL_RENDERBUFFER_BINDING 0x8CA7 +#define GL_READ_FRAMEBUFFER 0x8CA8 +#define GL_DRAW_FRAMEBUFFER 0x8CA9 +#define GL_READ_FRAMEBUFFER_BINDING 0x8CAA +#define GL_RENDERBUFFER_SAMPLES 0x8CAB +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS 0x8CDF +#define GL_COLOR_ATTACHMENT0 0x8CE0 +#define GL_COLOR_ATTACHMENT1 0x8CE1 +#define GL_COLOR_ATTACHMENT2 0x8CE2 +#define GL_COLOR_ATTACHMENT3 0x8CE3 +#define GL_COLOR_ATTACHMENT4 0x8CE4 +#define GL_COLOR_ATTACHMENT5 0x8CE5 +#define GL_COLOR_ATTACHMENT6 0x8CE6 +#define GL_COLOR_ATTACHMENT7 0x8CE7 +#define GL_COLOR_ATTACHMENT8 0x8CE8 +#define GL_COLOR_ATTACHMENT9 0x8CE9 +#define GL_COLOR_ATTACHMENT10 0x8CEA +#define GL_COLOR_ATTACHMENT11 0x8CEB +#define GL_COLOR_ATTACHMENT12 0x8CEC +#define GL_COLOR_ATTACHMENT13 0x8CED +#define GL_COLOR_ATTACHMENT14 0x8CEE +#define GL_COLOR_ATTACHMENT15 0x8CEF +#define GL_COLOR_ATTACHMENT16 0x8CF0 +#define GL_COLOR_ATTACHMENT17 0x8CF1 +#define GL_COLOR_ATTACHMENT18 0x8CF2 +#define GL_COLOR_ATTACHMENT19 0x8CF3 +#define GL_COLOR_ATTACHMENT20 0x8CF4 +#define GL_COLOR_ATTACHMENT21 0x8CF5 +#define GL_COLOR_ATTACHMENT22 0x8CF6 +#define GL_COLOR_ATTACHMENT23 0x8CF7 +#define GL_COLOR_ATTACHMENT24 0x8CF8 +#define GL_COLOR_ATTACHMENT25 0x8CF9 +#define GL_COLOR_ATTACHMENT26 0x8CFA +#define GL_COLOR_ATTACHMENT27 0x8CFB +#define GL_COLOR_ATTACHMENT28 0x8CFC +#define GL_COLOR_ATTACHMENT29 0x8CFD +#define GL_COLOR_ATTACHMENT30 0x8CFE +#define GL_COLOR_ATTACHMENT31 0x8CFF +#define GL_DEPTH_ATTACHMENT 0x8D00 +#define GL_STENCIL_ATTACHMENT 0x8D20 +#define GL_FRAMEBUFFER 0x8D40 +#define GL_RENDERBUFFER 0x8D41 +#define GL_RENDERBUFFER_WIDTH 0x8D42 +#define GL_RENDERBUFFER_HEIGHT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT 0x8D44 +#define GL_STENCIL_INDEX1 0x8D46 +#define GL_STENCIL_INDEX4 0x8D47 +#define GL_STENCIL_INDEX8 0x8D48 +#define GL_STENCIL_INDEX16 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE 0x8D55 +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE 0x8D56 +#define GL_MAX_SAMPLES 0x8D57 +#define GL_FRAMEBUFFER_SRGB 0x8DB9 +#define GL_HALF_FLOAT 0x140B +#define GL_MAP_READ_BIT 0x0001 +#define GL_MAP_WRITE_BIT 0x0002 +#define GL_MAP_INVALIDATE_RANGE_BIT 0x0004 +#define GL_MAP_INVALIDATE_BUFFER_BIT 0x0008 +#define GL_MAP_FLUSH_EXPLICIT_BIT 0x0010 +#define GL_MAP_UNSYNCHRONIZED_BIT 0x0020 +#define GL_COMPRESSED_RED_RGTC1 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1 0x8DBC +#define GL_COMPRESSED_RG_RGTC2 0x8DBD +#define GL_COMPRESSED_SIGNED_RG_RGTC2 0x8DBE +#define GL_RG 0x8227 +#define GL_RG_INTEGER 0x8228 +#define GL_R8 0x8229 +#define GL_R16 0x822A +#define GL_RG8 0x822B +#define GL_RG16 0x822C +#define GL_R16F 0x822D +#define GL_R32F 0x822E +#define GL_RG16F 0x822F +#define GL_RG32F 0x8230 +#define GL_R8I 0x8231 +#define GL_R8UI 0x8232 +#define GL_R16I 0x8233 +#define GL_R16UI 0x8234 +#define GL_R32I 0x8235 +#define GL_R32UI 0x8236 +#define GL_RG8I 0x8237 +#define GL_RG8UI 0x8238 +#define GL_RG16I 0x8239 +#define GL_RG16UI 0x823A +#define GL_RG32I 0x823B +#define GL_RG32UI 0x823C +#define GL_VERTEX_ARRAY_BINDING 0x85B5 +typedef void (APIENTRYP PFNGLCOLORMASKIPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (APIENTRYP PFNGLGETBOOLEANI_VPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINTEGERI_VPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLENABLEIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEIPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp); +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLGETUNIFORMUIVPROC) (GLuint program, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORM1UIPROC) (GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLUNIFORM2UIPROC) (GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLUNIFORM3UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLUNIFORM4UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLUNIFORM1UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM2UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM3UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM4UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLCLEARBUFFERIVPROC) (GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERUIVPROC) (GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFVPROC) (GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFIPROC) (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef const GLubyte *(APIENTRYP PFNGLGETSTRINGIPROC) (GLenum name, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPPROC) (GLenum target); +typedef void (APIENTRYP PFNGLBLITFRAMEBUFFERPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void *(APIENTRYP PFNGLMAPBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYPROC) (GLuint array); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorMaski (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GLAPI void APIENTRY glGetBooleani_v (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glGetIntegeri_v (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glEnablei (GLenum target, GLuint index); +GLAPI void APIENTRY glDisablei (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledi (GLenum target, GLuint index); +GLAPI void APIENTRY glBeginTransformFeedback (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedback (void); +GLAPI void APIENTRY glBindBufferRange (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferBase (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryings (GLuint program, GLsizei count, const GLchar *const*varyings, GLenum bufferMode); +GLAPI void APIENTRY glGetTransformFeedbackVarying (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glClampColor (GLenum target, GLenum clamp); +GLAPI void APIENTRY glBeginConditionalRender (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRender (void); +GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribIiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuiv (GLuint index, GLenum pname, GLuint *params); +GLAPI void APIENTRY glVertexAttribI1i (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2i (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3i (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4i (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1ui (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2ui (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3ui (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4ui (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glGetUniformuiv (GLuint program, GLint location, GLuint *params); +GLAPI void APIENTRY glBindFragDataLocation (GLuint program, GLuint color, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glUniform1ui (GLint location, GLuint v0); +GLAPI void APIENTRY glUniform2ui (GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glUniform3ui (GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glUniform4ui (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glUniform1uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform2uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform3uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform4uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glTexParameterIiv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexParameterIuiv (GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTexParameterIiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexParameterIuiv (GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glClearBufferiv (GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearBufferuiv (GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearBufferfv (GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearBufferfi (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI const GLubyte *APIENTRY glGetStringi (GLenum name, GLuint index); +GLAPI GLboolean APIENTRY glIsRenderbuffer (GLuint renderbuffer); +GLAPI void APIENTRY glBindRenderbuffer (GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glDeleteRenderbuffers (GLsizei n, const GLuint *renderbuffers); +GLAPI void APIENTRY glGenRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glRenderbufferStorage (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetRenderbufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsFramebuffer (GLuint framebuffer); +GLAPI void APIENTRY glBindFramebuffer (GLenum target, GLuint framebuffer); +GLAPI void APIENTRY glDeleteFramebuffers (GLsizei n, const GLuint *framebuffers); +GLAPI void APIENTRY glGenFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI GLenum APIENTRY glCheckFramebufferStatus (GLenum target); +GLAPI void APIENTRY glFramebufferTexture1D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture2D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture3D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glFramebufferRenderbuffer (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetFramebufferAttachmentParameteriv (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateMipmap (GLenum target); +GLAPI void APIENTRY glBlitFramebuffer (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI void APIENTRY glRenderbufferStorageMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glFramebufferTextureLayer (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void *APIENTRY glMapBufferRange (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedBufferRange (GLenum target, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glBindVertexArray (GLuint array); +GLAPI void APIENTRY glDeleteVertexArrays (GLsizei n, const GLuint *arrays); +GLAPI void APIENTRY glGenVertexArrays (GLsizei n, GLuint *arrays); +GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); +#endif +#endif /* GL_VERSION_3_0 */ + +#ifndef GL_VERSION_3_1 +#define GL_VERSION_3_1 1 +#define GL_SAMPLER_2D_RECT 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW 0x8B64 +#define GL_SAMPLER_BUFFER 0x8DC2 +#define GL_INT_SAMPLER_2D_RECT 0x8DCD +#define GL_INT_SAMPLER_BUFFER 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER 0x8DD8 +#define GL_TEXTURE_BUFFER 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING 0x8C2D +#define GL_TEXTURE_RECTANGLE 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE 0x84F8 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGB8_SNORM 0x8F96 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM 0x8F98 +#define GL_RG16_SNORM 0x8F99 +#define GL_RGB16_SNORM 0x8F9A +#define GL_RGBA16_SNORM 0x8F9B +#define GL_SIGNED_NORMALIZED 0x8F9C +#define GL_PRIMITIVE_RESTART 0x8F9D +#define GL_PRIMITIVE_RESTART_INDEX 0x8F9E +#define GL_COPY_READ_BUFFER 0x8F36 +#define GL_COPY_WRITE_BUFFER 0x8F37 +#define GL_UNIFORM_BUFFER 0x8A11 +#define GL_UNIFORM_BUFFER_BINDING 0x8A28 +#define GL_UNIFORM_BUFFER_START 0x8A29 +#define GL_UNIFORM_BUFFER_SIZE 0x8A2A +#define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C +#define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D +#define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E +#define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F +#define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 +#define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 +#define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 +#define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 +#define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 +#define GL_ACTIVE_UNIFORM_BLOCKS 0x8A36 +#define GL_UNIFORM_TYPE 0x8A37 +#define GL_UNIFORM_SIZE 0x8A38 +#define GL_UNIFORM_NAME_LENGTH 0x8A39 +#define GL_UNIFORM_BLOCK_INDEX 0x8A3A +#define GL_UNIFORM_OFFSET 0x8A3B +#define GL_UNIFORM_ARRAY_STRIDE 0x8A3C +#define GL_UNIFORM_MATRIX_STRIDE 0x8A3D +#define GL_UNIFORM_IS_ROW_MAJOR 0x8A3E +#define GL_UNIFORM_BLOCK_BINDING 0x8A3F +#define GL_UNIFORM_BLOCK_DATA_SIZE 0x8A40 +#define GL_UNIFORM_BLOCK_NAME_LENGTH 0x8A41 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 +#define GL_INVALID_INDEX 0xFFFFFFFFu +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); +typedef void (APIENTRYP PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint index); +typedef void (APIENTRYP PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETUNIFORMINDICESPROC) (GLuint program, GLsizei uniformCount, const GLchar *const*uniformNames, GLuint *uniformIndices); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMSIVPROC) (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMNAMEPROC) (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +typedef GLuint (APIENTRYP PFNGLGETUNIFORMBLOCKINDEXPROC) (GLuint program, const GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKIVPROC) (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstanced (GLenum mode, GLint first, GLsizei count, GLsizei instancecount); +GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount); +GLAPI void APIENTRY glTexBuffer (GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glPrimitiveRestartIndex (GLuint index); +GLAPI void APIENTRY glCopyBufferSubData (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glGetUniformIndices (GLuint program, GLsizei uniformCount, const GLchar *const*uniformNames, GLuint *uniformIndices); +GLAPI void APIENTRY glGetActiveUniformsiv (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformName (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +GLAPI GLuint APIENTRY glGetUniformBlockIndex (GLuint program, const GLchar *uniformBlockName); +GLAPI void APIENTRY glGetActiveUniformBlockiv (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformBlockName (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#endif +#endif /* GL_VERSION_3_1 */ + +#ifndef GL_VERSION_3_2 +#define GL_VERSION_3_2 1 +typedef struct __GLsync *GLsync; +typedef khronos_uint64_t GLuint64; +typedef khronos_int64_t GLint64; +#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 +#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 +#define GL_LINES_ADJACENCY 0x000A +#define GL_LINE_STRIP_ADJACENCY 0x000B +#define GL_TRIANGLES_ADJACENCY 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY 0x000D +#define GL_PROGRAM_POINT_SIZE 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS 0x8DA8 +#define GL_GEOMETRY_SHADER 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT 0x8916 +#define GL_GEOMETRY_INPUT_TYPE 0x8917 +#define GL_GEOMETRY_OUTPUT_TYPE 0x8918 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS 0x8DE1 +#define GL_MAX_VERTEX_OUTPUT_COMPONENTS 0x9122 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS 0x9124 +#define GL_MAX_FRAGMENT_INPUT_COMPONENTS 0x9125 +#define GL_CONTEXT_PROFILE_MASK 0x9126 +#define GL_DEPTH_CLAMP 0x864F +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION 0x8E4D +#define GL_LAST_VERTEX_CONVENTION 0x8E4E +#define GL_PROVOKING_VERTEX 0x8E4F +#define GL_TEXTURE_CUBE_MAP_SEAMLESS 0x884F +#define GL_MAX_SERVER_WAIT_TIMEOUT 0x9111 +#define GL_OBJECT_TYPE 0x9112 +#define GL_SYNC_CONDITION 0x9113 +#define GL_SYNC_STATUS 0x9114 +#define GL_SYNC_FLAGS 0x9115 +#define GL_SYNC_FENCE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE 0x9117 +#define GL_UNSIGNALED 0x9118 +#define GL_SIGNALED 0x9119 +#define GL_ALREADY_SIGNALED 0x911A +#define GL_TIMEOUT_EXPIRED 0x911B +#define GL_CONDITION_SATISFIED 0x911C +#define GL_WAIT_FAILED 0x911D +#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFFull +#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001 +#define GL_SAMPLE_POSITION 0x8E50 +#define GL_SAMPLE_MASK 0x8E51 +#define GL_SAMPLE_MASK_VALUE 0x8E52 +#define GL_MAX_SAMPLE_MASK_WORDS 0x8E59 +#define GL_TEXTURE_2D_MULTISAMPLE 0x9100 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE 0x9101 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9102 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9103 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE 0x9104 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY 0x9105 +#define GL_TEXTURE_SAMPLES 0x9106 +#define GL_TEXTURE_FIXED_SAMPLE_LOCATIONS 0x9107 +#define GL_SAMPLER_2D_MULTISAMPLE 0x9108 +#define GL_INT_SAMPLER_2D_MULTISAMPLE 0x9109 +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE 0x910A +#define GL_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910B +#define GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910C +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910D +#define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E +#define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F +#define GL_MAX_INTEGER_SAMPLES 0x9110 +typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +typedef void (APIENTRYP PFNGLPROVOKINGVERTEXPROC) (GLenum mode); +typedef GLsync (APIENTRYP PFNGLFENCESYNCPROC) (GLenum condition, GLbitfield flags); +typedef GLboolean (APIENTRYP PFNGLISSYNCPROC) (GLsync sync); +typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync); +typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data); +typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat *val); +typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint maskNumber, GLbitfield mask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); +GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount, const GLint *basevertex); +GLAPI void APIENTRY glProvokingVertex (GLenum mode); +GLAPI GLsync APIENTRY glFenceSync (GLenum condition, GLbitfield flags); +GLAPI GLboolean APIENTRY glIsSync (GLsync sync); +GLAPI void APIENTRY glDeleteSync (GLsync sync); +GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data); +GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values); +GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); +GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glGetMultisamplefv (GLenum pname, GLuint index, GLfloat *val); +GLAPI void APIENTRY glSampleMaski (GLuint maskNumber, GLbitfield mask); +#endif +#endif /* GL_VERSION_3_2 */ + +#ifndef GL_VERSION_3_3 +#define GL_VERSION_3_3 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR 0x88FE +#define GL_SRC1_COLOR 0x88F9 +#define GL_ONE_MINUS_SRC1_COLOR 0x88FA +#define GL_ONE_MINUS_SRC1_ALPHA 0x88FB +#define GL_MAX_DUAL_SOURCE_DRAW_BUFFERS 0x88FC +#define GL_ANY_SAMPLES_PASSED 0x8C2F +#define GL_SAMPLER_BINDING 0x8919 +#define GL_RGB10_A2UI 0x906F +#define GL_TEXTURE_SWIZZLE_R 0x8E42 +#define GL_TEXTURE_SWIZZLE_G 0x8E43 +#define GL_TEXTURE_SWIZZLE_B 0x8E44 +#define GL_TEXTURE_SWIZZLE_A 0x8E45 +#define GL_TEXTURE_SWIZZLE_RGBA 0x8E46 +#define GL_TIME_ELAPSED 0x88BF +#define GL_TIMESTAMP 0x8E28 +#define GL_INT_2_10_10_10_REV 0x8D9F +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONINDEXEDPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGENSAMPLERSPROC) (GLsizei count, GLuint *samplers); +typedef void (APIENTRYP PFNGLDELETESAMPLERSPROC) (GLsizei count, const GLuint *samplers); +typedef GLboolean (APIENTRYP PFNGLISSAMPLERPROC) (GLuint sampler); +typedef void (APIENTRYP PFNGLBINDSAMPLERPROC) (GLuint unit, GLuint sampler); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIPROC) (GLuint sampler, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFPROC) (GLuint sampler, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, const GLuint *param); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLQUERYCOUNTERPROC) (GLuint id, GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VPROC) (GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VPROC) (GLuint id, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORPROC) (GLuint index, GLuint divisor); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindFragDataLocationIndexed (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataIndex (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGenSamplers (GLsizei count, GLuint *samplers); +GLAPI void APIENTRY glDeleteSamplers (GLsizei count, const GLuint *samplers); +GLAPI GLboolean APIENTRY glIsSampler (GLuint sampler); +GLAPI void APIENTRY glBindSampler (GLuint unit, GLuint sampler); +GLAPI void APIENTRY glSamplerParameteri (GLuint sampler, GLenum pname, GLint param); +GLAPI void APIENTRY glSamplerParameteriv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterf (GLuint sampler, GLenum pname, GLfloat param); +GLAPI void APIENTRY glSamplerParameterfv (GLuint sampler, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glSamplerParameterIiv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterIuiv (GLuint sampler, GLenum pname, const GLuint *param); +GLAPI void APIENTRY glGetSamplerParameteriv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterIiv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterfv (GLuint sampler, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetSamplerParameterIuiv (GLuint sampler, GLenum pname, GLuint *params); +GLAPI void APIENTRY glQueryCounter (GLuint id, GLenum target); +GLAPI void APIENTRY glGetQueryObjecti64v (GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetQueryObjectui64v (GLuint id, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glVertexAttribDivisor (GLuint index, GLuint divisor); +GLAPI void APIENTRY glVertexAttribP1ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP1uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP2ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP2uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP3ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP3uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP4ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP4uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +#endif +#endif /* GL_VERSION_3_3 */ + +#ifndef GL_VERSION_4_0 +#define GL_VERSION_4_0 1 +#define GL_SAMPLE_SHADING 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE 0x8C37 +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5F +#define GL_TEXTURE_CUBE_MAP_ARRAY 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY 0x900F +#define GL_DRAW_INDIRECT_BUFFER 0x8F3F +#define GL_DRAW_INDIRECT_BUFFER_BINDING 0x8F43 +#define GL_GEOMETRY_SHADER_INVOCATIONS 0x887F +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS 0x8E5A +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET 0x8E5C +#define GL_FRAGMENT_INTERPOLATION_OFFSET_BITS 0x8E5D +#define GL_MAX_VERTEX_STREAMS 0x8E71 +#define GL_DOUBLE_VEC2 0x8FFC +#define GL_DOUBLE_VEC3 0x8FFD +#define GL_DOUBLE_VEC4 0x8FFE +#define GL_DOUBLE_MAT2 0x8F46 +#define GL_DOUBLE_MAT3 0x8F47 +#define GL_DOUBLE_MAT4 0x8F48 +#define GL_DOUBLE_MAT2x3 0x8F49 +#define GL_DOUBLE_MAT2x4 0x8F4A +#define GL_DOUBLE_MAT3x2 0x8F4B +#define GL_DOUBLE_MAT3x4 0x8F4C +#define GL_DOUBLE_MAT4x2 0x8F4D +#define GL_DOUBLE_MAT4x3 0x8F4E +#define GL_ACTIVE_SUBROUTINES 0x8DE5 +#define GL_ACTIVE_SUBROUTINE_UNIFORMS 0x8DE6 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_LOCATIONS 0x8E47 +#define GL_ACTIVE_SUBROUTINE_MAX_LENGTH 0x8E48 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_MAX_LENGTH 0x8E49 +#define GL_MAX_SUBROUTINES 0x8DE7 +#define GL_MAX_SUBROUTINE_UNIFORM_LOCATIONS 0x8DE8 +#define GL_NUM_COMPATIBLE_SUBROUTINES 0x8E4A +#define GL_COMPATIBLE_SUBROUTINES 0x8E4B +#define GL_PATCHES 0x000E +#define GL_PATCH_VERTICES 0x8E72 +#define GL_PATCH_DEFAULT_INNER_LEVEL 0x8E73 +#define GL_PATCH_DEFAULT_OUTER_LEVEL 0x8E74 +#define GL_TESS_CONTROL_OUTPUT_VERTICES 0x8E75 +#define GL_TESS_GEN_MODE 0x8E76 +#define GL_TESS_GEN_SPACING 0x8E77 +#define GL_TESS_GEN_VERTEX_ORDER 0x8E78 +#define GL_TESS_GEN_POINT_MODE 0x8E79 +#define GL_ISOLINES 0x8E7A +#define GL_FRACTIONAL_ODD 0x8E7B +#define GL_FRACTIONAL_EVEN 0x8E7C +#define GL_MAX_PATCH_VERTICES 0x8E7D +#define GL_MAX_TESS_GEN_LEVEL 0x8E7E +#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E7F +#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E80 +#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS 0x8E81 +#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS 0x8E82 +#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS 0x8E83 +#define GL_MAX_TESS_PATCH_COMPONENTS 0x8E84 +#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS 0x8E85 +#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS 0x8E86 +#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS 0x8E89 +#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS 0x8E8A +#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS 0x886C +#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS 0x886D +#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E1E +#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E1F +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_CONTROL_SHADER 0x84F0 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_EVALUATION_SHADER 0x84F1 +#define GL_TESS_EVALUATION_SHADER 0x8E87 +#define GL_TESS_CONTROL_SHADER 0x8E88 +#define GL_TRANSFORM_FEEDBACK 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING 0x8E25 +#define GL_MAX_TRANSFORM_FEEDBACK_BUFFERS 0x8E70 +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGPROC) (GLfloat value); +typedef void (APIENTRYP PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect); +typedef void (APIENTRYP PFNGLUNIFORM1DPROC) (GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLUNIFORM4DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLUNIFORM1DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM2DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM3DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM4DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, GLdouble *params); +typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices); +typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +typedef void (APIENTRYP PFNGLPATCHPARAMETERIPROC) (GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLPATCHPARAMETERFVPROC) (GLenum pname, const GLfloat *values); +typedef void (APIENTRYP PFNGLBINDTRANSFORMFEEDBACKPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETETRANSFORMFEEDBACKSPROC) (GLsizei n, const GLuint *ids); +typedef void (APIENTRYP PFNGLGENTRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISTRANSFORMFEEDBACKPROC) (GLuint id); +typedef void (APIENTRYP PFNGLPAUSETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLRESUMETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKPROC) (GLenum mode, GLuint id); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMPROC) (GLenum mode, GLuint id, GLuint stream); +typedef void (APIENTRYP PFNGLBEGINQUERYINDEXEDPROC) (GLenum target, GLuint index, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYINDEXEDPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLGETQUERYINDEXEDIVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShading (GLfloat value); +GLAPI void APIENTRY glBlendEquationi (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparatei (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunci (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparatei (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const void *indirect); +GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect); +GLAPI void APIENTRY glUniform1d (GLint location, GLdouble x); +GLAPI void APIENTRY glUniform2d (GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glUniform3d (GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glUniform4d (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glUniform1dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform2dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform3dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform4dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *params); +GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices); +GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params); +GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +GLAPI void APIENTRY glPatchParameteri (GLenum pname, GLint value); +GLAPI void APIENTRY glPatchParameterfv (GLenum pname, const GLfloat *values); +GLAPI void APIENTRY glBindTransformFeedback (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteTransformFeedbacks (GLsizei n, const GLuint *ids); +GLAPI void APIENTRY glGenTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI GLboolean APIENTRY glIsTransformFeedback (GLuint id); +GLAPI void APIENTRY glPauseTransformFeedback (void); +GLAPI void APIENTRY glResumeTransformFeedback (void); +GLAPI void APIENTRY glDrawTransformFeedback (GLenum mode, GLuint id); +GLAPI void APIENTRY glDrawTransformFeedbackStream (GLenum mode, GLuint id, GLuint stream); +GLAPI void APIENTRY glBeginQueryIndexed (GLenum target, GLuint index, GLuint id); +GLAPI void APIENTRY glEndQueryIndexed (GLenum target, GLuint index); +GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pname, GLint *params); +#endif +#endif /* GL_VERSION_4_0 */ + +#ifndef GL_VERSION_4_1 +#define GL_VERSION_4_1 1 +#define GL_FIXED 0x140C +#define GL_IMPLEMENTATION_COLOR_READ_TYPE 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT 0x8B9B +#define GL_LOW_FLOAT 0x8DF0 +#define GL_MEDIUM_FLOAT 0x8DF1 +#define GL_HIGH_FLOAT 0x8DF2 +#define GL_LOW_INT 0x8DF3 +#define GL_MEDIUM_INT 0x8DF4 +#define GL_HIGH_INT 0x8DF5 +#define GL_SHADER_COMPILER 0x8DFA +#define GL_SHADER_BINARY_FORMATS 0x8DF8 +#define GL_NUM_SHADER_BINARY_FORMATS 0x8DF9 +#define GL_MAX_VERTEX_UNIFORM_VECTORS 0x8DFB +#define GL_MAX_VARYING_VECTORS 0x8DFC +#define GL_MAX_FRAGMENT_UNIFORM_VECTORS 0x8DFD +#define GL_RGB565 0x8D62 +#define GL_PROGRAM_BINARY_RETRIEVABLE_HINT 0x8257 +#define GL_PROGRAM_BINARY_LENGTH 0x8741 +#define GL_NUM_PROGRAM_BINARY_FORMATS 0x87FE +#define GL_PROGRAM_BINARY_FORMATS 0x87FF +#define GL_VERTEX_SHADER_BIT 0x00000001 +#define GL_FRAGMENT_SHADER_BIT 0x00000002 +#define GL_GEOMETRY_SHADER_BIT 0x00000004 +#define GL_TESS_CONTROL_SHADER_BIT 0x00000008 +#define GL_TESS_EVALUATION_SHADER_BIT 0x00000010 +#define GL_ALL_SHADER_BITS 0xFFFFFFFF +#define GL_PROGRAM_SEPARABLE 0x8258 +#define GL_ACTIVE_PROGRAM 0x8259 +#define GL_PROGRAM_PIPELINE_BINDING 0x825A +#define GL_MAX_VIEWPORTS 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE 0x825D +#define GL_LAYER_PROVOKING_VERTEX 0x825E +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F +#define GL_UNDEFINED_VERTEX 0x8260 +typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); +typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLfloat n, GLfloat f); +typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLfloat d); +typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program); +typedef void (APIENTRYP PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMVPROC) (GLenum type, GLsizei count, const GLchar *const*strings); +typedef void (APIENTRYP PFNGLBINDPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPIPELINESPROC) (GLsizei n, const GLuint *pipelines); +typedef void (APIENTRYP PFNGLGENPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEIVPROC) (GLuint pipeline, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DPROC) (GLuint program, GLint location, GLdouble v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEINFOLOGPROC) (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLSCISSORARRAYVPROC) (GLuint first, GLsizei count, const GLint *v); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYVPROC) (GLuint first, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDPROC) (GLuint index, GLdouble n, GLdouble f); +typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReleaseShaderCompiler (void); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryFormat, const void *binary, GLsizei length); +GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +GLAPI void APIENTRY glDepthRangef (GLfloat n, GLfloat f); +GLAPI void APIENTRY glClearDepthf (GLfloat d); +GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, void *binary); +GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const void *binary, GLsizei length); +GLAPI void APIENTRY glProgramParameteri (GLuint program, GLenum pname, GLint value); +GLAPI void APIENTRY glUseProgramStages (GLuint pipeline, GLbitfield stages, GLuint program); +GLAPI void APIENTRY glActiveShaderProgram (GLuint pipeline, GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramv (GLenum type, GLsizei count, const GLchar *const*strings); +GLAPI void APIENTRY glBindProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glDeleteProgramPipelines (GLsizei n, const GLuint *pipelines); +GLAPI void APIENTRY glGenProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI GLboolean APIENTRY glIsProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineiv (GLuint pipeline, GLenum pname, GLint *params); +GLAPI void APIENTRY glProgramUniform1i (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform1iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform1f (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform1fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1d (GLuint program, GLint location, GLdouble v0); +GLAPI void APIENTRY glProgramUniform1dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform1ui (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform1uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2i (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform2iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2f (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform2fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2d (GLuint program, GLint location, GLdouble v0, GLdouble v1); +GLAPI void APIENTRY glProgramUniform2dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2ui (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform2uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform3iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform3fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +GLAPI void APIENTRY glProgramUniform3dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform3uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform4iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform4fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +GLAPI void APIENTRY glProgramUniform4dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform4uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glValidateProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineInfoLog (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glVertexAttribL1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttribL2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttribL3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttribL4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttribL1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glGetVertexAttribLdv (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glViewportArrayv (GLuint first, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glViewportIndexedf (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +GLAPI void APIENTRY glViewportIndexedfv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glScissorArrayv (GLuint first, GLsizei count, const GLint *v); +GLAPI void APIENTRY glScissorIndexed (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorIndexedv (GLuint index, const GLint *v); +GLAPI void APIENTRY glDepthRangeArrayv (GLuint first, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glDepthRangeIndexed (GLuint index, GLdouble n, GLdouble f); +GLAPI void APIENTRY glGetFloati_v (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data); +#endif +#endif /* GL_VERSION_4_1 */ + +#ifndef GL_VERSION_4_2 +#define GL_VERSION_4_2 1 +#define GL_COPY_READ_BUFFER_BINDING 0x8F36 +#define GL_COPY_WRITE_BUFFER_BINDING 0x8F37 +#define GL_TRANSFORM_FEEDBACK_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_PAUSED 0x8E23 +#define GL_UNPACK_COMPRESSED_BLOCK_WIDTH 0x9127 +#define GL_UNPACK_COMPRESSED_BLOCK_HEIGHT 0x9128 +#define GL_UNPACK_COMPRESSED_BLOCK_DEPTH 0x9129 +#define GL_UNPACK_COMPRESSED_BLOCK_SIZE 0x912A +#define GL_PACK_COMPRESSED_BLOCK_WIDTH 0x912B +#define GL_PACK_COMPRESSED_BLOCK_HEIGHT 0x912C +#define GL_PACK_COMPRESSED_BLOCK_DEPTH 0x912D +#define GL_PACK_COMPRESSED_BLOCK_SIZE 0x912E +#define GL_NUM_SAMPLE_COUNTS 0x9380 +#define GL_MIN_MAP_BUFFER_ALIGNMENT 0x90BC +#define GL_ATOMIC_COUNTER_BUFFER 0x92C0 +#define GL_ATOMIC_COUNTER_BUFFER_BINDING 0x92C1 +#define GL_ATOMIC_COUNTER_BUFFER_START 0x92C2 +#define GL_ATOMIC_COUNTER_BUFFER_SIZE 0x92C3 +#define GL_ATOMIC_COUNTER_BUFFER_DATA_SIZE 0x92C4 +#define GL_ATOMIC_COUNTER_BUFFER_ACTIVE_ATOMIC_COUNTERS 0x92C5 +#define GL_ATOMIC_COUNTER_BUFFER_ACTIVE_ATOMIC_COUNTER_INDICES 0x92C6 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_VERTEX_SHADER 0x92C7 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TESS_CONTROL_SHADER 0x92C8 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TESS_EVALUATION_SHADER 0x92C9 +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_GEOMETRY_SHADER 0x92CA +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_FRAGMENT_SHADER 0x92CB +#define GL_MAX_VERTEX_ATOMIC_COUNTER_BUFFERS 0x92CC +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTER_BUFFERS 0x92CD +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTER_BUFFERS 0x92CE +#define GL_MAX_GEOMETRY_ATOMIC_COUNTER_BUFFERS 0x92CF +#define GL_MAX_FRAGMENT_ATOMIC_COUNTER_BUFFERS 0x92D0 +#define GL_MAX_COMBINED_ATOMIC_COUNTER_BUFFERS 0x92D1 +#define GL_MAX_VERTEX_ATOMIC_COUNTERS 0x92D2 +#define GL_MAX_TESS_CONTROL_ATOMIC_COUNTERS 0x92D3 +#define GL_MAX_TESS_EVALUATION_ATOMIC_COUNTERS 0x92D4 +#define GL_MAX_GEOMETRY_ATOMIC_COUNTERS 0x92D5 +#define GL_MAX_FRAGMENT_ATOMIC_COUNTERS 0x92D6 +#define GL_MAX_COMBINED_ATOMIC_COUNTERS 0x92D7 +#define GL_MAX_ATOMIC_COUNTER_BUFFER_SIZE 0x92D8 +#define GL_MAX_ATOMIC_COUNTER_BUFFER_BINDINGS 0x92DC +#define GL_ACTIVE_ATOMIC_COUNTER_BUFFERS 0x92D9 +#define GL_UNIFORM_ATOMIC_COUNTER_BUFFER_INDEX 0x92DA +#define GL_UNSIGNED_INT_ATOMIC_COUNTER 0x92DB +#define GL_VERTEX_ATTRIB_ARRAY_BARRIER_BIT 0x00000001 +#define GL_ELEMENT_ARRAY_BARRIER_BIT 0x00000002 +#define GL_UNIFORM_BARRIER_BIT 0x00000004 +#define GL_TEXTURE_FETCH_BARRIER_BIT 0x00000008 +#define GL_SHADER_IMAGE_ACCESS_BARRIER_BIT 0x00000020 +#define GL_COMMAND_BARRIER_BIT 0x00000040 +#define GL_PIXEL_BUFFER_BARRIER_BIT 0x00000080 +#define GL_TEXTURE_UPDATE_BARRIER_BIT 0x00000100 +#define GL_BUFFER_UPDATE_BARRIER_BIT 0x00000200 +#define GL_FRAMEBUFFER_BARRIER_BIT 0x00000400 +#define GL_TRANSFORM_FEEDBACK_BARRIER_BIT 0x00000800 +#define GL_ATOMIC_COUNTER_BARRIER_BIT 0x00001000 +#define GL_ALL_BARRIER_BITS 0xFFFFFFFF +#define GL_MAX_IMAGE_UNITS 0x8F38 +#define GL_MAX_COMBINED_IMAGE_UNITS_AND_FRAGMENT_OUTPUTS 0x8F39 +#define GL_IMAGE_BINDING_NAME 0x8F3A +#define GL_IMAGE_BINDING_LEVEL 0x8F3B +#define GL_IMAGE_BINDING_LAYERED 0x8F3C +#define GL_IMAGE_BINDING_LAYER 0x8F3D +#define GL_IMAGE_BINDING_ACCESS 0x8F3E +#define GL_IMAGE_1D 0x904C +#define GL_IMAGE_2D 0x904D +#define GL_IMAGE_3D 0x904E +#define GL_IMAGE_2D_RECT 0x904F +#define GL_IMAGE_CUBE 0x9050 +#define GL_IMAGE_BUFFER 0x9051 +#define GL_IMAGE_1D_ARRAY 0x9052 +#define GL_IMAGE_2D_ARRAY 0x9053 +#define GL_IMAGE_CUBE_MAP_ARRAY 0x9054 +#define GL_IMAGE_2D_MULTISAMPLE 0x9055 +#define GL_IMAGE_2D_MULTISAMPLE_ARRAY 0x9056 +#define GL_INT_IMAGE_1D 0x9057 +#define GL_INT_IMAGE_2D 0x9058 +#define GL_INT_IMAGE_3D 0x9059 +#define GL_INT_IMAGE_2D_RECT 0x905A +#define GL_INT_IMAGE_CUBE 0x905B +#define GL_INT_IMAGE_BUFFER 0x905C +#define GL_INT_IMAGE_1D_ARRAY 0x905D +#define GL_INT_IMAGE_2D_ARRAY 0x905E +#define GL_INT_IMAGE_CUBE_MAP_ARRAY 0x905F +#define GL_INT_IMAGE_2D_MULTISAMPLE 0x9060 +#define GL_INT_IMAGE_2D_MULTISAMPLE_ARRAY 0x9061 +#define GL_UNSIGNED_INT_IMAGE_1D 0x9062 +#define GL_UNSIGNED_INT_IMAGE_2D 0x9063 +#define GL_UNSIGNED_INT_IMAGE_3D 0x9064 +#define GL_UNSIGNED_INT_IMAGE_2D_RECT 0x9065 +#define GL_UNSIGNED_INT_IMAGE_CUBE 0x9066 +#define GL_UNSIGNED_INT_IMAGE_BUFFER 0x9067 +#define GL_UNSIGNED_INT_IMAGE_1D_ARRAY 0x9068 +#define GL_UNSIGNED_INT_IMAGE_2D_ARRAY 0x9069 +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY 0x906A +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE 0x906B +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_ARRAY 0x906C +#define GL_MAX_IMAGE_SAMPLES 0x906D +#define GL_IMAGE_BINDING_FORMAT 0x906E +#define GL_IMAGE_FORMAT_COMPATIBILITY_TYPE 0x90C7 +#define GL_IMAGE_FORMAT_COMPATIBILITY_BY_SIZE 0x90C8 +#define GL_IMAGE_FORMAT_COMPATIBILITY_BY_CLASS 0x90C9 +#define GL_MAX_VERTEX_IMAGE_UNIFORMS 0x90CA +#define GL_MAX_TESS_CONTROL_IMAGE_UNIFORMS 0x90CB +#define GL_MAX_TESS_EVALUATION_IMAGE_UNIFORMS 0x90CC +#define GL_MAX_GEOMETRY_IMAGE_UNIFORMS 0x90CD +#define GL_MAX_FRAGMENT_IMAGE_UNIFORMS 0x90CE +#define GL_MAX_COMBINED_IMAGE_UNIFORMS 0x90CF +#define GL_COMPRESSED_RGBA_BPTC_UNORM 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT 0x8E8F +#define GL_TEXTURE_IMMUTABLE_FORMAT 0x912F +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); +typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLTEXSTORAGE1DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKINSTANCEDPROC) (GLenum mode, GLuint id, GLsizei instancecount); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum mode, GLuint id, GLuint stream, GLsizei instancecount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); +GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); +GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params); +GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); +GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); +GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); +GLAPI void APIENTRY glTexStorage1D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTexStorage2D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexStorage3D (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glDrawTransformFeedbackInstanced (GLenum mode, GLuint id, GLsizei instancecount); +GLAPI void APIENTRY glDrawTransformFeedbackStreamInstanced (GLenum mode, GLuint id, GLuint stream, GLsizei instancecount); +#endif +#endif /* GL_VERSION_4_2 */ + +#ifndef GL_VERSION_4_3 +#define GL_VERSION_4_3 1 +typedef void (APIENTRY *GLDEBUGPROC)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); +#define GL_NUM_SHADING_LANGUAGE_VERSIONS 0x82E9 +#define GL_VERTEX_ATTRIB_ARRAY_LONG 0x874E +#define GL_COMPRESSED_RGB8_ETC2 0x9274 +#define GL_COMPRESSED_SRGB8_ETC2 0x9275 +#define GL_COMPRESSED_RGB8_PUNCHTHROUGH_ALPHA1_ETC2 0x9276 +#define GL_COMPRESSED_SRGB8_PUNCHTHROUGH_ALPHA1_ETC2 0x9277 +#define GL_COMPRESSED_RGBA8_ETC2_EAC 0x9278 +#define GL_COMPRESSED_SRGB8_ALPHA8_ETC2_EAC 0x9279 +#define GL_COMPRESSED_R11_EAC 0x9270 +#define GL_COMPRESSED_SIGNED_R11_EAC 0x9271 +#define GL_COMPRESSED_RG11_EAC 0x9272 +#define GL_COMPRESSED_SIGNED_RG11_EAC 0x9273 +#define GL_PRIMITIVE_RESTART_FIXED_INDEX 0x8D69 +#define GL_ANY_SAMPLES_PASSED_CONSERVATIVE 0x8D6A +#define GL_MAX_ELEMENT_INDEX 0x8D6B +#define GL_COMPUTE_SHADER 0x91B9 +#define GL_MAX_COMPUTE_UNIFORM_BLOCKS 0x91BB +#define GL_MAX_COMPUTE_TEXTURE_IMAGE_UNITS 0x91BC +#define GL_MAX_COMPUTE_IMAGE_UNIFORMS 0x91BD +#define GL_MAX_COMPUTE_SHARED_MEMORY_SIZE 0x8262 +#define GL_MAX_COMPUTE_UNIFORM_COMPONENTS 0x8263 +#define GL_MAX_COMPUTE_ATOMIC_COUNTER_BUFFERS 0x8264 +#define GL_MAX_COMPUTE_ATOMIC_COUNTERS 0x8265 +#define GL_MAX_COMBINED_COMPUTE_UNIFORM_COMPONENTS 0x8266 +#define GL_MAX_COMPUTE_WORK_GROUP_INVOCATIONS 0x90EB +#define GL_MAX_COMPUTE_WORK_GROUP_COUNT 0x91BE +#define GL_MAX_COMPUTE_WORK_GROUP_SIZE 0x91BF +#define GL_COMPUTE_WORK_GROUP_SIZE 0x8267 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_COMPUTE_SHADER 0x90EC +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_COMPUTE_SHADER 0x90ED +#define GL_DISPATCH_INDIRECT_BUFFER 0x90EE +#define GL_DISPATCH_INDIRECT_BUFFER_BINDING 0x90EF +#define GL_COMPUTE_SHADER_BIT 0x00000020 +#define GL_DEBUG_OUTPUT_SYNCHRONOUS 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM 0x8245 +#define GL_DEBUG_SOURCE_API 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION 0x824A +#define GL_DEBUG_SOURCE_OTHER 0x824B +#define GL_DEBUG_TYPE_ERROR 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR 0x824E +#define GL_DEBUG_TYPE_PORTABILITY 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE 0x8250 +#define GL_DEBUG_TYPE_OTHER 0x8251 +#define GL_MAX_DEBUG_MESSAGE_LENGTH 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES 0x9145 +#define GL_DEBUG_SEVERITY_HIGH 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM 0x9147 +#define GL_DEBUG_SEVERITY_LOW 0x9148 +#define GL_DEBUG_TYPE_MARKER 0x8268 +#define GL_DEBUG_TYPE_PUSH_GROUP 0x8269 +#define GL_DEBUG_TYPE_POP_GROUP 0x826A +#define GL_DEBUG_SEVERITY_NOTIFICATION 0x826B +#define GL_MAX_DEBUG_GROUP_STACK_DEPTH 0x826C +#define GL_DEBUG_GROUP_STACK_DEPTH 0x826D +#define GL_BUFFER 0x82E0 +#define GL_SHADER 0x82E1 +#define GL_PROGRAM 0x82E2 +#define GL_QUERY 0x82E3 +#define GL_PROGRAM_PIPELINE 0x82E4 +#define GL_SAMPLER 0x82E6 +#define GL_MAX_LABEL_LENGTH 0x82E8 +#define GL_DEBUG_OUTPUT 0x92E0 +#define GL_CONTEXT_FLAG_DEBUG_BIT 0x00000002 +#define GL_MAX_UNIFORM_LOCATIONS 0x826E +#define GL_FRAMEBUFFER_DEFAULT_WIDTH 0x9310 +#define GL_FRAMEBUFFER_DEFAULT_HEIGHT 0x9311 +#define GL_FRAMEBUFFER_DEFAULT_LAYERS 0x9312 +#define GL_FRAMEBUFFER_DEFAULT_SAMPLES 0x9313 +#define GL_FRAMEBUFFER_DEFAULT_FIXED_SAMPLE_LOCATIONS 0x9314 +#define GL_MAX_FRAMEBUFFER_WIDTH 0x9315 +#define GL_MAX_FRAMEBUFFER_HEIGHT 0x9316 +#define GL_MAX_FRAMEBUFFER_LAYERS 0x9317 +#define GL_MAX_FRAMEBUFFER_SAMPLES 0x9318 +#define GL_INTERNALFORMAT_SUPPORTED 0x826F +#define GL_INTERNALFORMAT_PREFERRED 0x8270 +#define GL_INTERNALFORMAT_RED_SIZE 0x8271 +#define GL_INTERNALFORMAT_GREEN_SIZE 0x8272 +#define GL_INTERNALFORMAT_BLUE_SIZE 0x8273 +#define GL_INTERNALFORMAT_ALPHA_SIZE 0x8274 +#define GL_INTERNALFORMAT_DEPTH_SIZE 0x8275 +#define GL_INTERNALFORMAT_STENCIL_SIZE 0x8276 +#define GL_INTERNALFORMAT_SHARED_SIZE 0x8277 +#define GL_INTERNALFORMAT_RED_TYPE 0x8278 +#define GL_INTERNALFORMAT_GREEN_TYPE 0x8279 +#define GL_INTERNALFORMAT_BLUE_TYPE 0x827A +#define GL_INTERNALFORMAT_ALPHA_TYPE 0x827B +#define GL_INTERNALFORMAT_DEPTH_TYPE 0x827C +#define GL_INTERNALFORMAT_STENCIL_TYPE 0x827D +#define GL_MAX_WIDTH 0x827E +#define GL_MAX_HEIGHT 0x827F +#define GL_MAX_DEPTH 0x8280 +#define GL_MAX_LAYERS 0x8281 +#define GL_MAX_COMBINED_DIMENSIONS 0x8282 +#define GL_COLOR_COMPONENTS 0x8283 +#define GL_DEPTH_COMPONENTS 0x8284 +#define GL_STENCIL_COMPONENTS 0x8285 +#define GL_COLOR_RENDERABLE 0x8286 +#define GL_DEPTH_RENDERABLE 0x8287 +#define GL_STENCIL_RENDERABLE 0x8288 +#define GL_FRAMEBUFFER_RENDERABLE 0x8289 +#define GL_FRAMEBUFFER_RENDERABLE_LAYERED 0x828A +#define GL_FRAMEBUFFER_BLEND 0x828B +#define GL_READ_PIXELS 0x828C +#define GL_READ_PIXELS_FORMAT 0x828D +#define GL_READ_PIXELS_TYPE 0x828E +#define GL_TEXTURE_IMAGE_FORMAT 0x828F +#define GL_TEXTURE_IMAGE_TYPE 0x8290 +#define GL_GET_TEXTURE_IMAGE_FORMAT 0x8291 +#define GL_GET_TEXTURE_IMAGE_TYPE 0x8292 +#define GL_MIPMAP 0x8293 +#define GL_MANUAL_GENERATE_MIPMAP 0x8294 +#define GL_AUTO_GENERATE_MIPMAP 0x8295 +#define GL_COLOR_ENCODING 0x8296 +#define GL_SRGB_READ 0x8297 +#define GL_SRGB_WRITE 0x8298 +#define GL_FILTER 0x829A +#define GL_VERTEX_TEXTURE 0x829B +#define GL_TESS_CONTROL_TEXTURE 0x829C +#define GL_TESS_EVALUATION_TEXTURE 0x829D +#define GL_GEOMETRY_TEXTURE 0x829E +#define GL_FRAGMENT_TEXTURE 0x829F +#define GL_COMPUTE_TEXTURE 0x82A0 +#define GL_TEXTURE_SHADOW 0x82A1 +#define GL_TEXTURE_GATHER 0x82A2 +#define GL_TEXTURE_GATHER_SHADOW 0x82A3 +#define GL_SHADER_IMAGE_LOAD 0x82A4 +#define GL_SHADER_IMAGE_STORE 0x82A5 +#define GL_SHADER_IMAGE_ATOMIC 0x82A6 +#define GL_IMAGE_TEXEL_SIZE 0x82A7 +#define GL_IMAGE_COMPATIBILITY_CLASS 0x82A8 +#define GL_IMAGE_PIXEL_FORMAT 0x82A9 +#define GL_IMAGE_PIXEL_TYPE 0x82AA +#define GL_SIMULTANEOUS_TEXTURE_AND_DEPTH_TEST 0x82AC +#define GL_SIMULTANEOUS_TEXTURE_AND_STENCIL_TEST 0x82AD +#define GL_SIMULTANEOUS_TEXTURE_AND_DEPTH_WRITE 0x82AE +#define GL_SIMULTANEOUS_TEXTURE_AND_STENCIL_WRITE 0x82AF +#define GL_TEXTURE_COMPRESSED_BLOCK_WIDTH 0x82B1 +#define GL_TEXTURE_COMPRESSED_BLOCK_HEIGHT 0x82B2 +#define GL_TEXTURE_COMPRESSED_BLOCK_SIZE 0x82B3 +#define GL_CLEAR_BUFFER 0x82B4 +#define GL_TEXTURE_VIEW 0x82B5 +#define GL_VIEW_COMPATIBILITY_CLASS 0x82B6 +#define GL_FULL_SUPPORT 0x82B7 +#define GL_CAVEAT_SUPPORT 0x82B8 +#define GL_IMAGE_CLASS_4_X_32 0x82B9 +#define GL_IMAGE_CLASS_2_X_32 0x82BA +#define GL_IMAGE_CLASS_1_X_32 0x82BB +#define GL_IMAGE_CLASS_4_X_16 0x82BC +#define GL_IMAGE_CLASS_2_X_16 0x82BD +#define GL_IMAGE_CLASS_1_X_16 0x82BE +#define GL_IMAGE_CLASS_4_X_8 0x82BF +#define GL_IMAGE_CLASS_2_X_8 0x82C0 +#define GL_IMAGE_CLASS_1_X_8 0x82C1 +#define GL_IMAGE_CLASS_11_11_10 0x82C2 +#define GL_IMAGE_CLASS_10_10_10_2 0x82C3 +#define GL_VIEW_CLASS_128_BITS 0x82C4 +#define GL_VIEW_CLASS_96_BITS 0x82C5 +#define GL_VIEW_CLASS_64_BITS 0x82C6 +#define GL_VIEW_CLASS_48_BITS 0x82C7 +#define GL_VIEW_CLASS_32_BITS 0x82C8 +#define GL_VIEW_CLASS_24_BITS 0x82C9 +#define GL_VIEW_CLASS_16_BITS 0x82CA +#define GL_VIEW_CLASS_8_BITS 0x82CB +#define GL_VIEW_CLASS_S3TC_DXT1_RGB 0x82CC +#define GL_VIEW_CLASS_S3TC_DXT1_RGBA 0x82CD +#define GL_VIEW_CLASS_S3TC_DXT3_RGBA 0x82CE +#define GL_VIEW_CLASS_S3TC_DXT5_RGBA 0x82CF +#define GL_VIEW_CLASS_RGTC1_RED 0x82D0 +#define GL_VIEW_CLASS_RGTC2_RG 0x82D1 +#define GL_VIEW_CLASS_BPTC_UNORM 0x82D2 +#define GL_VIEW_CLASS_BPTC_FLOAT 0x82D3 +#define GL_UNIFORM 0x92E1 +#define GL_UNIFORM_BLOCK 0x92E2 +#define GL_PROGRAM_INPUT 0x92E3 +#define GL_PROGRAM_OUTPUT 0x92E4 +#define GL_BUFFER_VARIABLE 0x92E5 +#define GL_SHADER_STORAGE_BLOCK 0x92E6 +#define GL_VERTEX_SUBROUTINE 0x92E8 +#define GL_TESS_CONTROL_SUBROUTINE 0x92E9 +#define GL_TESS_EVALUATION_SUBROUTINE 0x92EA +#define GL_GEOMETRY_SUBROUTINE 0x92EB +#define GL_FRAGMENT_SUBROUTINE 0x92EC +#define GL_COMPUTE_SUBROUTINE 0x92ED +#define GL_VERTEX_SUBROUTINE_UNIFORM 0x92EE +#define GL_TESS_CONTROL_SUBROUTINE_UNIFORM 0x92EF +#define GL_TESS_EVALUATION_SUBROUTINE_UNIFORM 0x92F0 +#define GL_GEOMETRY_SUBROUTINE_UNIFORM 0x92F1 +#define GL_FRAGMENT_SUBROUTINE_UNIFORM 0x92F2 +#define GL_COMPUTE_SUBROUTINE_UNIFORM 0x92F3 +#define GL_TRANSFORM_FEEDBACK_VARYING 0x92F4 +#define GL_ACTIVE_RESOURCES 0x92F5 +#define GL_MAX_NAME_LENGTH 0x92F6 +#define GL_MAX_NUM_ACTIVE_VARIABLES 0x92F7 +#define GL_MAX_NUM_COMPATIBLE_SUBROUTINES 0x92F8 +#define GL_NAME_LENGTH 0x92F9 +#define GL_TYPE 0x92FA +#define GL_ARRAY_SIZE 0x92FB +#define GL_OFFSET 0x92FC +#define GL_BLOCK_INDEX 0x92FD +#define GL_ARRAY_STRIDE 0x92FE +#define GL_MATRIX_STRIDE 0x92FF +#define GL_IS_ROW_MAJOR 0x9300 +#define GL_ATOMIC_COUNTER_BUFFER_INDEX 0x9301 +#define GL_BUFFER_BINDING 0x9302 +#define GL_BUFFER_DATA_SIZE 0x9303 +#define GL_NUM_ACTIVE_VARIABLES 0x9304 +#define GL_ACTIVE_VARIABLES 0x9305 +#define GL_REFERENCED_BY_VERTEX_SHADER 0x9306 +#define GL_REFERENCED_BY_TESS_CONTROL_SHADER 0x9307 +#define GL_REFERENCED_BY_TESS_EVALUATION_SHADER 0x9308 +#define GL_REFERENCED_BY_GEOMETRY_SHADER 0x9309 +#define GL_REFERENCED_BY_FRAGMENT_SHADER 0x930A +#define GL_REFERENCED_BY_COMPUTE_SHADER 0x930B +#define GL_TOP_LEVEL_ARRAY_SIZE 0x930C +#define GL_TOP_LEVEL_ARRAY_STRIDE 0x930D +#define GL_LOCATION 0x930E +#define GL_LOCATION_INDEX 0x930F +#define GL_IS_PER_PATCH 0x92E7 +#define GL_SHADER_STORAGE_BUFFER 0x90D2 +#define GL_SHADER_STORAGE_BUFFER_BINDING 0x90D3 +#define GL_SHADER_STORAGE_BUFFER_START 0x90D4 +#define GL_SHADER_STORAGE_BUFFER_SIZE 0x90D5 +#define GL_MAX_VERTEX_SHADER_STORAGE_BLOCKS 0x90D6 +#define GL_MAX_GEOMETRY_SHADER_STORAGE_BLOCKS 0x90D7 +#define GL_MAX_TESS_CONTROL_SHADER_STORAGE_BLOCKS 0x90D8 +#define GL_MAX_TESS_EVALUATION_SHADER_STORAGE_BLOCKS 0x90D9 +#define GL_MAX_FRAGMENT_SHADER_STORAGE_BLOCKS 0x90DA +#define GL_MAX_COMPUTE_SHADER_STORAGE_BLOCKS 0x90DB +#define GL_MAX_COMBINED_SHADER_STORAGE_BLOCKS 0x90DC +#define GL_MAX_SHADER_STORAGE_BUFFER_BINDINGS 0x90DD +#define GL_MAX_SHADER_STORAGE_BLOCK_SIZE 0x90DE +#define GL_SHADER_STORAGE_BUFFER_OFFSET_ALIGNMENT 0x90DF +#define GL_SHADER_STORAGE_BARRIER_BIT 0x00002000 +#define GL_MAX_COMBINED_SHADER_OUTPUT_RESOURCES 0x8F39 +#define GL_DEPTH_STENCIL_TEXTURE_MODE 0x90EA +#define GL_TEXTURE_BUFFER_OFFSET 0x919D +#define GL_TEXTURE_BUFFER_SIZE 0x919E +#define GL_TEXTURE_BUFFER_OFFSET_ALIGNMENT 0x919F +#define GL_TEXTURE_VIEW_MIN_LEVEL 0x82DB +#define GL_TEXTURE_VIEW_NUM_LEVELS 0x82DC +#define GL_TEXTURE_VIEW_MIN_LAYER 0x82DD +#define GL_TEXTURE_VIEW_NUM_LAYERS 0x82DE +#define GL_TEXTURE_IMMUTABLE_LEVELS 0x82DF +#define GL_VERTEX_ATTRIB_BINDING 0x82D4 +#define GL_VERTEX_ATTRIB_RELATIVE_OFFSET 0x82D5 +#define GL_VERTEX_BINDING_DIVISOR 0x82D6 +#define GL_VERTEX_BINDING_OFFSET 0x82D7 +#define GL_VERTEX_BINDING_STRIDE 0x82D8 +#define GL_MAX_VERTEX_ATTRIB_RELATIVE_OFFSET 0x82D9 +#define GL_MAX_VERTEX_ATTRIB_BINDINGS 0x82DA +#define GL_VERTEX_BINDING_BUFFER 0x8F4F +typedef void (APIENTRYP PFNGLCLEARBUFFERDATAPROC) (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARBUFFERSUBDATAPROC) (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z); +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params); +typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLINVALIDATEBUFFERDATAPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLINVALIDATEFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATESUBFRAMEBUFFERPROC) (GLenum target, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTPROC) (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params); +typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params); +typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); +typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); +typedef void (APIENTRYP PFNGLTEXBUFFERRANGEPROC) (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTUREVIEWPROC) (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +typedef void (APIENTRYP PFNGLBINDVERTEXBUFFERPROC) (GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLFORMATPROC) (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXATTRIBBINDINGPROC) (GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXBINDINGDIVISORPROC) (GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKPROC) (GLDEBUGPROC callback, const void *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +typedef void (APIENTRYP PFNGLPUSHDEBUGGROUPPROC) (GLenum source, GLuint id, GLsizei length, const GLchar *message); +typedef void (APIENTRYP PFNGLPOPDEBUGGROUPPROC) (void); +typedef void (APIENTRYP PFNGLOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTLABELPROC) (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); +typedef void (APIENTRYP PFNGLOBJECTPTRLABELPROC) (const void *ptr, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTPTRLABELPROC) (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClearBufferData (GLenum target, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearBufferSubData (GLenum target, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glDispatchCompute (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z); +GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect); +GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); +GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params); +GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); +GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glInvalidateBufferData (GLuint buffer); +GLAPI void APIENTRY glInvalidateFramebuffer (GLenum target, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateSubFramebuffer (GLenum target, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glMultiDrawArraysIndirect (GLenum mode, const void *indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const void *indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params); +GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params); +GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name); +GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); +GLAPI void APIENTRY glTexBufferRange (GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTexStorage2DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexStorage3DMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureView (GLuint texture, GLenum target, GLuint origtexture, GLenum internalformat, GLuint minlevel, GLuint numlevels, GLuint minlayer, GLuint numlayers); +GLAPI void APIENTRY glBindVertexBuffer (GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexAttribFormat (GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribIFormat (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribLFormat (GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexAttribBinding (GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexBindingDivisor (GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glDebugMessageControl (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsert (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallback (GLDEBUGPROC callback, const void *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLog (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +GLAPI void APIENTRY glPushDebugGroup (GLenum source, GLuint id, GLsizei length, const GLchar *message); +GLAPI void APIENTRY glPopDebugGroup (void); +GLAPI void APIENTRY glObjectLabel (GLenum identifier, GLuint name, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectLabel (GLenum identifier, GLuint name, GLsizei bufSize, GLsizei *length, GLchar *label); +GLAPI void APIENTRY glObjectPtrLabel (const void *ptr, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectPtrLabel (const void *ptr, GLsizei bufSize, GLsizei *length, GLchar *label); +#endif +#endif /* GL_VERSION_4_3 */ + +#ifndef GL_VERSION_4_4 +#define GL_VERSION_4_4 1 +#define GL_MAX_VERTEX_ATTRIB_STRIDE 0x82E5 +#define GL_PRIMITIVE_RESTART_FOR_PATCHES_SUPPORTED 0x8221 +#define GL_TEXTURE_BUFFER_BINDING 0x8C2A +#define GL_MAP_PERSISTENT_BIT 0x0040 +#define GL_MAP_COHERENT_BIT 0x0080 +#define GL_DYNAMIC_STORAGE_BIT 0x0100 +#define GL_CLIENT_STORAGE_BIT 0x0200 +#define GL_CLIENT_MAPPED_BUFFER_BARRIER_BIT 0x00004000 +#define GL_BUFFER_IMMUTABLE_STORAGE 0x821F +#define GL_BUFFER_STORAGE_FLAGS 0x8220 +#define GL_CLEAR_TEXTURE 0x9365 +#define GL_LOCATION_COMPONENT 0x934A +#define GL_TRANSFORM_FEEDBACK_BUFFER_INDEX 0x934B +#define GL_TRANSFORM_FEEDBACK_BUFFER_STRIDE 0x934C +#define GL_QUERY_BUFFER 0x9192 +#define GL_QUERY_BUFFER_BARRIER_BIT 0x00008000 +#define GL_QUERY_BUFFER_BINDING 0x9193 +#define GL_QUERY_RESULT_NO_WAIT 0x9194 +#define GL_MIRROR_CLAMP_TO_EDGE 0x8743 +typedef void (APIENTRYP PFNGLBUFFERSTORAGEPROC) (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLCLEARTEXIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARTEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLBINDBUFFERSBASEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint *buffers); +typedef void (APIENTRYP PFNGLBINDBUFFERSRANGEPROC) (GLenum target, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizeiptr *sizes); +typedef void (APIENTRYP PFNGLBINDTEXTURESPROC) (GLuint first, GLsizei count, const GLuint *textures); +typedef void (APIENTRYP PFNGLBINDSAMPLERSPROC) (GLuint first, GLsizei count, const GLuint *samplers); +typedef void (APIENTRYP PFNGLBINDIMAGETEXTURESPROC) (GLuint first, GLsizei count, const GLuint *textures); +typedef void (APIENTRYP PFNGLBINDVERTEXBUFFERSPROC) (GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorage (GLenum target, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glClearTexImage (GLuint texture, GLint level, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glBindBuffersBase (GLenum target, GLuint first, GLsizei count, const GLuint *buffers); +GLAPI void APIENTRY glBindBuffersRange (GLenum target, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizeiptr *sizes); +GLAPI void APIENTRY glBindTextures (GLuint first, GLsizei count, const GLuint *textures); +GLAPI void APIENTRY glBindSamplers (GLuint first, GLsizei count, const GLuint *samplers); +GLAPI void APIENTRY glBindImageTextures (GLuint first, GLsizei count, const GLuint *textures); +GLAPI void APIENTRY glBindVertexBuffers (GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +#endif +#endif /* GL_VERSION_4_4 */ + +#ifndef GL_VERSION_4_5 +#define GL_VERSION_4_5 1 +#define GL_CONTEXT_LOST 0x0507 +#define GL_NEGATIVE_ONE_TO_ONE 0x935E +#define GL_ZERO_TO_ONE 0x935F +#define GL_CLIP_ORIGIN 0x935C +#define GL_CLIP_DEPTH_MODE 0x935D +#define GL_QUERY_WAIT_INVERTED 0x8E17 +#define GL_QUERY_NO_WAIT_INVERTED 0x8E18 +#define GL_QUERY_BY_REGION_WAIT_INVERTED 0x8E19 +#define GL_QUERY_BY_REGION_NO_WAIT_INVERTED 0x8E1A +#define GL_MAX_CULL_DISTANCES 0x82F9 +#define GL_MAX_COMBINED_CLIP_AND_CULL_DISTANCES 0x82FA +#define GL_TEXTURE_TARGET 0x1006 +#define GL_QUERY_TARGET 0x82EA +#define GL_GUILTY_CONTEXT_RESET 0x8253 +#define GL_INNOCENT_CONTEXT_RESET 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY 0x8256 +#define GL_LOSE_CONTEXT_ON_RESET 0x8252 +#define GL_NO_RESET_NOTIFICATION 0x8261 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT 0x00000004 +#define GL_CONTEXT_RELEASE_BEHAVIOR 0x82FB +#define GL_CONTEXT_RELEASE_BEHAVIOR_FLUSH 0x82FC +typedef void (APIENTRYP PFNGLCLIPCONTROLPROC) (GLenum origin, GLenum depth); +typedef void (APIENTRYP PFNGLCREATETRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERBASEPROC) (GLuint xfb, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKBUFFERRANGEPROC) (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKIVPROC) (GLuint xfb, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint *param); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKI64_VPROC) (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATEBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void (APIENTRYP PFNGLCOPYNAMEDBUFFERSUBDATAPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERPROC) (GLuint buffer, GLenum access); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERI64VPROC) (GLuint buffer, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLCREATEFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFERPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYERPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERPROC) (GLuint framebuffer, GLenum buf); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERDRAWBUFFERSPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERREADBUFFERPROC) (GLuint framebuffer, GLenum src); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +typedef void (APIENTRYP PFNGLINVALIDATENAMEDFRAMEBUFFERSUBDATAPROC) (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERUIVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFVPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARNAMEDFRAMEBUFFERFIPROC) (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef void (APIENTRYP PFNGLBLITNAMEDFRAMEBUFFERPROC) (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVPROC) (GLuint framebuffer, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATERENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATETEXTURESPROC) (GLenum target, GLsizei n, GLuint *textures); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERPROC) (GLuint texture, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEPROC) (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DPROC) (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEPROC) (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DPROC) (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFPROC) (GLuint texture, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIPROC) (GLuint texture, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLBINDTEXTUREUNITPROC) (GLuint unit, GLuint texture); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEPROC) (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVPROC) (GLuint texture, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVPROC) (GLuint texture, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVPROC) (GLuint texture, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVPROC) (GLuint texture, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVPROC) (GLuint texture, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCREATEVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLVERTEXARRAYELEMENTBUFFERPROC) (GLuint vaobj, GLuint buffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBUFFERSPROC) (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBBINDINGPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBIFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYATTRIBLFORMATPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDINGDIVISORPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYIVPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXEDIVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINDEXED64IVPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +typedef void (APIENTRYP PFNGLCREATESAMPLERSPROC) (GLsizei n, GLuint *samplers); +typedef void (APIENTRYP PFNGLCREATEPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef void (APIENTRYP PFNGLCREATEQUERIESPROC) (GLenum target, GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUI64VPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLGETQUERYBUFFEROBJECTUIVPROC) (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +typedef void (APIENTRYP PFNGLMEMORYBARRIERBYREGIONPROC) (GLbitfield barriers); +typedef void (APIENTRYP PFNGLGETTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTURESUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSPROC) (void); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLREADNPIXELSPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLTEXTUREBARRIERPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClipControl (GLenum origin, GLenum depth); +GLAPI void APIENTRY glCreateTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glTransformFeedbackBufferBase (GLuint xfb, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackBufferRange (GLuint xfb, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glGetTransformFeedbackiv (GLuint xfb, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki_v (GLuint xfb, GLenum pname, GLuint index, GLint *param); +GLAPI void APIENTRY glGetTransformFeedbacki64_v (GLuint xfb, GLenum pname, GLuint index, GLint64 *param); +GLAPI void APIENTRY glCreateBuffers (GLsizei n, GLuint *buffers); +GLAPI void APIENTRY glNamedBufferStorage (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferData (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void APIENTRY glCopyNamedBufferSubData (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glClearNamedBufferData (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubData (GLuint buffer, GLenum internalformat, GLintptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void *APIENTRY glMapNamedBuffer (GLuint buffer, GLenum access); +GLAPI void *APIENTRY glMapNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI GLboolean APIENTRY glUnmapNamedBuffer (GLuint buffer); +GLAPI void APIENTRY glFlushMappedNamedBufferRange (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glGetNamedBufferParameteriv (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferParameteri64v (GLuint buffer, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetNamedBufferPointerv (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glCreateFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI void APIENTRY glNamedFramebufferRenderbuffer (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glNamedFramebufferParameteri (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glNamedFramebufferTexture (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayer (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferDrawBuffer (GLuint framebuffer, GLenum buf); +GLAPI void APIENTRY glNamedFramebufferDrawBuffers (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glNamedFramebufferReadBuffer (GLuint framebuffer, GLenum src); +GLAPI void APIENTRY glInvalidateNamedFramebufferData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments); +GLAPI void APIENTRY glInvalidateNamedFramebufferSubData (GLuint framebuffer, GLsizei numAttachments, const GLenum *attachments, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glClearNamedFramebufferiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearNamedFramebufferuiv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearNamedFramebufferfv (GLuint framebuffer, GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearNamedFramebufferfi (GLuint framebuffer, GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI void APIENTRY glBlitNamedFramebuffer (GLuint readFramebuffer, GLuint drawFramebuffer, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatus (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glGetNamedFramebufferParameteriv (GLuint framebuffer, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameteriv (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glNamedRenderbufferStorage (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisample (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameteriv (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateTextures (GLenum target, GLsizei n, GLuint *textures); +GLAPI void APIENTRY glTextureBuffer (GLuint texture, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureBufferRange (GLuint texture, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3D (GLuint texture, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisample (GLuint texture, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCompressedTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCompressedTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *data); +GLAPI void APIENTRY glCopyTextureSubImage1D (GLuint texture, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTextureSubImage3D (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureParameterf (GLuint texture, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfv (GLuint texture, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glTextureParameteri (GLuint texture, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterIiv (GLuint texture, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuiv (GLuint texture, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glTextureParameteriv (GLuint texture, GLenum pname, const GLint *param); +GLAPI void APIENTRY glGenerateTextureMipmap (GLuint texture); +GLAPI void APIENTRY glBindTextureUnit (GLuint unit, GLuint texture); +GLAPI void APIENTRY glGetTextureImage (GLuint texture, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureImage (GLuint texture, GLint level, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetTextureLevelParameterfv (GLuint texture, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameteriv (GLuint texture, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterfv (GLuint texture, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterIiv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuiv (GLuint texture, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetTextureParameteriv (GLuint texture, GLenum pname, GLint *params); +GLAPI void APIENTRY glCreateVertexArrays (GLsizei n, GLuint *arrays); +GLAPI void APIENTRY glDisableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glEnableVertexArrayAttrib (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glVertexArrayElementBuffer (GLuint vaobj, GLuint buffer); +GLAPI void APIENTRY glVertexArrayVertexBuffer (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexBuffers (GLuint vaobj, GLuint first, GLsizei count, const GLuint *buffers, const GLintptr *offsets, const GLsizei *strides); +GLAPI void APIENTRY glVertexArrayAttribBinding (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayAttribFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribIFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayAttribLFormat (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayBindingDivisor (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glGetVertexArrayiv (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexediv (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayIndexed64iv (GLuint vaobj, GLuint index, GLenum pname, GLint64 *param); +GLAPI void APIENTRY glCreateSamplers (GLsizei n, GLuint *samplers); +GLAPI void APIENTRY glCreateProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI void APIENTRY glCreateQueries (GLenum target, GLsizei n, GLuint *ids); +GLAPI void APIENTRY glGetQueryBufferObjecti64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectui64v (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glGetQueryBufferObjectuiv (GLuint id, GLuint buffer, GLenum pname, GLintptr offset); +GLAPI void APIENTRY glMemoryBarrierByRegion (GLbitfield barriers); +GLAPI void APIENTRY glGetTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetCompressedTextureSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei bufSize, void *pixels); +GLAPI GLenum APIENTRY glGetGraphicsResetStatus (void); +GLAPI void APIENTRY glGetnCompressedTexImage (GLenum target, GLint lod, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnTexImage (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *pixels); +GLAPI void APIENTRY glGetnUniformdv (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +GLAPI void APIENTRY glGetnUniformfv (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformiv (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuiv (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glReadnPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glTextureBarrier (void); +#endif +#endif /* GL_VERSION_4_5 */ + +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +typedef void (APIENTRYP PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShader (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +GLAPI void APIENTRY glMultiDrawArraysIndirectCount (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCount (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glPolygonOffsetClamp (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_VERSION_4_6 */ + +#ifndef GL_ARB_ES2_compatibility +#define GL_ARB_ES2_compatibility 1 +#endif /* GL_ARB_ES2_compatibility */ + +#ifndef GL_ARB_ES3_1_compatibility +#define GL_ARB_ES3_1_compatibility 1 +#endif /* GL_ARB_ES3_1_compatibility */ + +#ifndef GL_ARB_ES3_2_compatibility +#define GL_ARB_ES3_2_compatibility 1 +#define GL_PRIMITIVE_BOUNDING_BOX_ARB 0x92BE +#define GL_MULTISAMPLE_LINE_WIDTH_RANGE_ARB 0x9381 +#define GL_MULTISAMPLE_LINE_WIDTH_GRANULARITY_ARB 0x9382 +typedef void (APIENTRYP PFNGLPRIMITIVEBOUNDINGBOXARBPROC) (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLfloat minZ, GLfloat minW, GLfloat maxX, GLfloat maxY, GLfloat maxZ, GLfloat maxW); +#endif +#endif /* GL_ARB_ES3_2_compatibility */ + +#ifndef GL_ARB_ES3_compatibility +#define GL_ARB_ES3_compatibility 1 +#endif /* GL_ARB_ES3_compatibility */ + +#ifndef GL_ARB_arrays_of_arrays +#define GL_ARB_arrays_of_arrays 1 +#endif /* GL_ARB_arrays_of_arrays */ + +#ifndef GL_ARB_base_instance +#define GL_ARB_base_instance 1 +#endif /* GL_ARB_base_instance */ + +#ifndef GL_ARB_bindless_texture +#define GL_ARB_bindless_texture 1 +typedef khronos_uint64_t GLuint64EXT; +#define GL_UNSIGNED_INT64_ARB 0x140F +typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture); +typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLENONRESIDENTARBPROC) (GLuint64 handle); +typedef GLuint64 (APIENTRYP PFNGLGETIMAGEHANDLEARBPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle, GLenum access); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLENONRESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64ARBPROC) (GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64ARBPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef GLboolean (APIENTRYP PFNGLISIMAGEHANDLERESIDENTARBPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64ARBPROC) (GLuint index, GLuint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64VARBPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLUI64VARBPROC) (GLuint index, GLenum pname, GLuint64EXT *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint64 APIENTRY glGetTextureHandleARB (GLuint texture); +GLAPI GLuint64 APIENTRY glGetTextureSamplerHandleARB (GLuint texture, GLuint sampler); +GLAPI void APIENTRY glMakeTextureHandleResidentARB (GLuint64 handle); +GLAPI void APIENTRY glMakeTextureHandleNonResidentARB (GLuint64 handle); +GLAPI GLuint64 APIENTRY glGetImageHandleARB (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +GLAPI void APIENTRY glMakeImageHandleResidentARB (GLuint64 handle, GLenum access); +GLAPI void APIENTRY glMakeImageHandleNonResidentARB (GLuint64 handle); +GLAPI void APIENTRY glUniformHandleui64ARB (GLint location, GLuint64 value); +GLAPI void APIENTRY glUniformHandleui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniformHandleui64ARB (GLuint program, GLint location, GLuint64 value); +GLAPI void APIENTRY glProgramUniformHandleui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +GLAPI GLboolean APIENTRY glIsTextureHandleResidentARB (GLuint64 handle); +GLAPI GLboolean APIENTRY glIsImageHandleResidentARB (GLuint64 handle); +GLAPI void APIENTRY glVertexAttribL1ui64ARB (GLuint index, GLuint64EXT x); +GLAPI void APIENTRY glVertexAttribL1ui64vARB (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glGetVertexAttribLui64vARB (GLuint index, GLenum pname, GLuint64EXT *params); +#endif +#endif /* GL_ARB_bindless_texture */ + +#ifndef GL_ARB_blend_func_extended +#define GL_ARB_blend_func_extended 1 +#endif /* GL_ARB_blend_func_extended */ + +#ifndef GL_ARB_buffer_storage +#define GL_ARB_buffer_storage 1 +#endif /* GL_ARB_buffer_storage */ + +#ifndef GL_ARB_cl_event +#define GL_ARB_cl_event 1 +struct _cl_context; +struct _cl_event; +#define GL_SYNC_CL_EVENT_ARB 0x8240 +#define GL_SYNC_CL_EVENT_COMPLETE_ARB 0x8241 +typedef GLsync (APIENTRYP PFNGLCREATESYNCFROMCLEVENTARBPROC) (struct _cl_context *context, struct _cl_event *event, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLsync APIENTRY glCreateSyncFromCLeventARB (struct _cl_context *context, struct _cl_event *event, GLbitfield flags); +#endif +#endif /* GL_ARB_cl_event */ + +#ifndef GL_ARB_clear_buffer_object +#define GL_ARB_clear_buffer_object 1 +#endif /* GL_ARB_clear_buffer_object */ + +#ifndef GL_ARB_clear_texture +#define GL_ARB_clear_texture 1 +#endif /* GL_ARB_clear_texture */ + +#ifndef GL_ARB_clip_control +#define GL_ARB_clip_control 1 +#endif /* GL_ARB_clip_control */ + +#ifndef GL_ARB_compressed_texture_pixel_storage +#define GL_ARB_compressed_texture_pixel_storage 1 +#endif /* GL_ARB_compressed_texture_pixel_storage */ + +#ifndef GL_ARB_compute_shader +#define GL_ARB_compute_shader 1 +#endif /* GL_ARB_compute_shader */ + +#ifndef GL_ARB_compute_variable_group_size +#define GL_ARB_compute_variable_group_size 1 +#define GL_MAX_COMPUTE_VARIABLE_GROUP_INVOCATIONS_ARB 0x9344 +#define GL_MAX_COMPUTE_FIXED_GROUP_INVOCATIONS_ARB 0x90EB +#define GL_MAX_COMPUTE_VARIABLE_GROUP_SIZE_ARB 0x9345 +#define GL_MAX_COMPUTE_FIXED_GROUP_SIZE_ARB 0x91BF +typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEGROUPSIZEARBPROC) (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDispatchComputeGroupSizeARB (GLuint num_groups_x, GLuint num_groups_y, GLuint num_groups_z, GLuint group_size_x, GLuint group_size_y, GLuint group_size_z); +#endif +#endif /* GL_ARB_compute_variable_group_size */ + +#ifndef GL_ARB_conditional_render_inverted +#define GL_ARB_conditional_render_inverted 1 +#endif /* GL_ARB_conditional_render_inverted */ + +#ifndef GL_ARB_conservative_depth +#define GL_ARB_conservative_depth 1 +#endif /* GL_ARB_conservative_depth */ + +#ifndef GL_ARB_copy_buffer +#define GL_ARB_copy_buffer 1 +#endif /* GL_ARB_copy_buffer */ + +#ifndef GL_ARB_copy_image +#define GL_ARB_copy_image 1 +#endif /* GL_ARB_copy_image */ + +#ifndef GL_ARB_cull_distance +#define GL_ARB_cull_distance 1 +#endif /* GL_ARB_cull_distance */ + +#ifndef GL_ARB_debug_output +#define GL_ARB_debug_output 1 +typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,const void *userParam); +#define GL_DEBUG_OUTPUT_SYNCHRONOUS_ARB 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH_ARB 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION_ARB 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM_ARB 0x8245 +#define GL_DEBUG_SOURCE_API_ARB 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM_ARB 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER_ARB 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY_ARB 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION_ARB 0x824A +#define GL_DEBUG_SOURCE_OTHER_ARB 0x824B +#define GL_DEBUG_TYPE_ERROR_ARB 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR_ARB 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR_ARB 0x824E +#define GL_DEBUG_TYPE_PORTABILITY_ARB 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE_ARB 0x8250 +#define GL_DEBUG_TYPE_OTHER_ARB 0x8251 +#define GL_MAX_DEBUG_MESSAGE_LENGTH_ARB 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES_ARB 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_ARB 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_ARB 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_ARB 0x9147 +#define GL_DEBUG_SEVERITY_LOW_ARB 0x9148 +typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKARBPROC) (GLDEBUGPROCARB callback, const void *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDebugMessageControlARB (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsertARB (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallbackARB (GLDEBUGPROCARB callback, const void *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufSize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#endif +#endif /* GL_ARB_debug_output */ + +#ifndef GL_ARB_depth_buffer_float +#define GL_ARB_depth_buffer_float 1 +#endif /* GL_ARB_depth_buffer_float */ + +#ifndef GL_ARB_depth_clamp +#define GL_ARB_depth_clamp 1 +#endif /* GL_ARB_depth_clamp */ + +#ifndef GL_ARB_derivative_control +#define GL_ARB_derivative_control 1 +#endif /* GL_ARB_derivative_control */ + +#ifndef GL_ARB_direct_state_access +#define GL_ARB_direct_state_access 1 +#endif /* GL_ARB_direct_state_access */ + +#ifndef GL_ARB_draw_buffers_blend +#define GL_ARB_draw_buffers_blend 1 +typedef void (APIENTRYP PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationiARB (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparateiARB (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunciARB (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparateiARB (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif +#endif /* GL_ARB_draw_buffers_blend */ + +#ifndef GL_ARB_draw_elements_base_vertex +#define GL_ARB_draw_elements_base_vertex 1 +#endif /* GL_ARB_draw_elements_base_vertex */ + +#ifndef GL_ARB_draw_indirect +#define GL_ARB_draw_indirect 1 +#endif /* GL_ARB_draw_indirect */ + +#ifndef GL_ARB_draw_instanced +#define GL_ARB_draw_instanced 1 +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedARB (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#endif +#endif /* GL_ARB_draw_instanced */ + +#ifndef GL_ARB_enhanced_layouts +#define GL_ARB_enhanced_layouts 1 +#endif /* GL_ARB_enhanced_layouts */ + +#ifndef GL_ARB_explicit_attrib_location +#define GL_ARB_explicit_attrib_location 1 +#endif /* GL_ARB_explicit_attrib_location */ + +#ifndef GL_ARB_explicit_uniform_location +#define GL_ARB_explicit_uniform_location 1 +#endif /* GL_ARB_explicit_uniform_location */ + +#ifndef GL_ARB_fragment_coord_conventions +#define GL_ARB_fragment_coord_conventions 1 +#endif /* GL_ARB_fragment_coord_conventions */ + +#ifndef GL_ARB_fragment_layer_viewport +#define GL_ARB_fragment_layer_viewport 1 +#endif /* GL_ARB_fragment_layer_viewport */ + +#ifndef GL_ARB_fragment_shader_interlock +#define GL_ARB_fragment_shader_interlock 1 +#endif /* GL_ARB_fragment_shader_interlock */ + +#ifndef GL_ARB_framebuffer_no_attachments +#define GL_ARB_framebuffer_no_attachments 1 +#endif /* GL_ARB_framebuffer_no_attachments */ + +#ifndef GL_ARB_framebuffer_object +#define GL_ARB_framebuffer_object 1 +#endif /* GL_ARB_framebuffer_object */ + +#ifndef GL_ARB_framebuffer_sRGB +#define GL_ARB_framebuffer_sRGB 1 +#endif /* GL_ARB_framebuffer_sRGB */ + +#ifndef GL_ARB_geometry_shader4 +#define GL_ARB_geometry_shader4 1 +#define GL_LINES_ADJACENCY_ARB 0x000A +#define GL_LINE_STRIP_ADJACENCY_ARB 0x000B +#define GL_TRIANGLES_ADJACENCY_ARB 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_ARB 0x000D +#define GL_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_ARB 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_ARB 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_ARB 0x8DA8 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_ARB 0x8DA9 +#define GL_GEOMETRY_SHADER_ARB 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT_ARB 0x8DDA +#define GL_GEOMETRY_INPUT_TYPE_ARB 0x8DDB +#define GL_GEOMETRY_OUTPUT_TYPE_ARB 0x8DDC +#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_ARB 0x8DDD +#define GL_MAX_VERTEX_VARYING_COMPONENTS_ARB 0x8DDE +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_ARB 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_ARB 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_ARB 0x8DE1 +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIARBPROC) (GLuint program, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramParameteriARB (GLuint program, GLenum pname, GLint value); +GLAPI void APIENTRY glFramebufferTextureARB (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTextureLayerARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif +#endif /* GL_ARB_geometry_shader4 */ + +#ifndef GL_ARB_get_program_binary +#define GL_ARB_get_program_binary 1 +#endif /* GL_ARB_get_program_binary */ + +#ifndef GL_ARB_get_texture_sub_image +#define GL_ARB_get_texture_sub_image 1 +#endif /* GL_ARB_get_texture_sub_image */ + +#ifndef GL_ARB_gl_spirv +#define GL_ARB_gl_spirv 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V_ARB 0x9551 +#define GL_SPIR_V_BINARY_ARB 0x9552 +typedef void (APIENTRYP PFNGLSPECIALIZESHADERARBPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShaderARB (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +#endif +#endif /* GL_ARB_gl_spirv */ + +#ifndef GL_ARB_gpu_shader5 +#define GL_ARB_gpu_shader5 1 +#endif /* GL_ARB_gpu_shader5 */ + +#ifndef GL_ARB_gpu_shader_fp64 +#define GL_ARB_gpu_shader_fp64 1 +#endif /* GL_ARB_gpu_shader_fp64 */ + +#ifndef GL_ARB_gpu_shader_int64 +#define GL_ARB_gpu_shader_int64 1 +#define GL_INT64_ARB 0x140E +#define GL_INT64_VEC2_ARB 0x8FE9 +#define GL_INT64_VEC3_ARB 0x8FEA +#define GL_INT64_VEC4_ARB 0x8FEB +#define GL_UNSIGNED_INT64_VEC2_ARB 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_ARB 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_ARB 0x8FF7 +typedef void (APIENTRYP PFNGLUNIFORM1I64ARBPROC) (GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2I64ARBPROC) (GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4I64ARBPROC) (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VARBPROC) (GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64ARBPROC) (GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64ARBPROC) (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VARBPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VARBPROC) (GLuint program, GLint location, GLint64 *params); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLuint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUI64VARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64ARBPROC) (GLuint program, GLint location, GLint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64ARBPROC) (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64ARBPROC) (GLuint program, GLint location, GLuint64 x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64ARBPROC) (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VARBPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64ARB (GLint location, GLint64 x); +GLAPI void APIENTRY glUniform2i64ARB (GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glUniform3i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glUniform4i64ARB (GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glUniform1i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform2i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform3i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform4i64vARB (GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glUniform1ui64ARB (GLint location, GLuint64 x); +GLAPI void APIENTRY glUniform2ui64ARB (GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glUniform3ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glUniform4ui64ARB (GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glUniform1ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform2ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform3ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glUniform4ui64vARB (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glGetUniformi64vARB (GLuint program, GLint location, GLint64 *params); +GLAPI void APIENTRY glGetUniformui64vARB (GLuint program, GLint location, GLuint64 *params); +GLAPI void APIENTRY glGetnUniformi64vARB (GLuint program, GLint location, GLsizei bufSize, GLint64 *params); +GLAPI void APIENTRY glGetnUniformui64vARB (GLuint program, GLint location, GLsizei bufSize, GLuint64 *params); +GLAPI void APIENTRY glProgramUniform1i64ARB (GLuint program, GLint location, GLint64 x); +GLAPI void APIENTRY glProgramUniform2i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y); +GLAPI void APIENTRY glProgramUniform3i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z); +GLAPI void APIENTRY glProgramUniform4i64ARB (GLuint program, GLint location, GLint64 x, GLint64 y, GLint64 z, GLint64 w); +GLAPI void APIENTRY glProgramUniform1i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform2i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform3i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform4i64vARB (GLuint program, GLint location, GLsizei count, const GLint64 *value); +GLAPI void APIENTRY glProgramUniform1ui64ARB (GLuint program, GLint location, GLuint64 x); +GLAPI void APIENTRY glProgramUniform2ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y); +GLAPI void APIENTRY glProgramUniform3ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z); +GLAPI void APIENTRY glProgramUniform4ui64ARB (GLuint program, GLint location, GLuint64 x, GLuint64 y, GLuint64 z, GLuint64 w); +GLAPI void APIENTRY glProgramUniform1ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform2ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform3ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, GLsizei count, const GLuint64 *value); +#endif +#endif /* GL_ARB_gpu_shader_int64 */ + +#ifndef GL_ARB_half_float_vertex +#define GL_ARB_half_float_vertex 1 +#endif /* GL_ARB_half_float_vertex */ + +#ifndef GL_ARB_imaging +#define GL_ARB_imaging 1 +#endif /* GL_ARB_imaging */ + +#ifndef GL_ARB_indirect_parameters +#define GL_ARB_indirect_parameters 1 +#define GL_PARAMETER_BUFFER_ARB 0x80EE +#define GL_PARAMETER_BUFFER_BINDING_ARB 0x80EF +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_ARB_indirect_parameters */ + +#ifndef GL_ARB_instanced_arrays +#define GL_ARB_instanced_arrays 1 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_ARB 0x88FE +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORARBPROC) (GLuint index, GLuint divisor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); +#endif +#endif /* GL_ARB_instanced_arrays */ + +#ifndef GL_ARB_internalformat_query +#define GL_ARB_internalformat_query 1 +#endif /* GL_ARB_internalformat_query */ + +#ifndef GL_ARB_internalformat_query2 +#define GL_ARB_internalformat_query2 1 +#define GL_SRGB_DECODE_ARB 0x8299 +#define GL_VIEW_CLASS_EAC_R11 0x9383 +#define GL_VIEW_CLASS_EAC_RG11 0x9384 +#define GL_VIEW_CLASS_ETC2_RGB 0x9385 +#define GL_VIEW_CLASS_ETC2_RGBA 0x9386 +#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387 +#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388 +#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389 +#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A +#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B +#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C +#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D +#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E +#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F +#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390 +#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391 +#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392 +#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393 +#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394 +#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395 +#endif /* GL_ARB_internalformat_query2 */ + +#ifndef GL_ARB_invalidate_subdata +#define GL_ARB_invalidate_subdata 1 +#endif /* GL_ARB_invalidate_subdata */ + +#ifndef GL_ARB_map_buffer_alignment +#define GL_ARB_map_buffer_alignment 1 +#endif /* GL_ARB_map_buffer_alignment */ + +#ifndef GL_ARB_map_buffer_range +#define GL_ARB_map_buffer_range 1 +#endif /* GL_ARB_map_buffer_range */ + +#ifndef GL_ARB_multi_bind +#define GL_ARB_multi_bind 1 +#endif /* GL_ARB_multi_bind */ + +#ifndef GL_ARB_multi_draw_indirect +#define GL_ARB_multi_draw_indirect 1 +#endif /* GL_ARB_multi_draw_indirect */ + +#ifndef GL_ARB_occlusion_query2 +#define GL_ARB_occlusion_query2 1 +#endif /* GL_ARB_occlusion_query2 */ + +#ifndef GL_ARB_parallel_shader_compile +#define GL_ARB_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_ARB 0x91B0 +#define GL_COMPLETION_STATUS_ARB 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSARBPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsARB (GLuint count); +#endif +#endif /* GL_ARB_parallel_shader_compile */ + +#ifndef GL_ARB_pipeline_statistics_query +#define GL_ARB_pipeline_statistics_query 1 +#define GL_VERTICES_SUBMITTED_ARB 0x82EE +#define GL_PRIMITIVES_SUBMITTED_ARB 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS_ARB 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES_ARB 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS_ARB 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED_ARB 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS_ARB 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS_ARB 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES_ARB 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES_ARB 0x82F7 +#endif /* GL_ARB_pipeline_statistics_query */ + +#ifndef GL_ARB_pixel_buffer_object +#define GL_ARB_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF +#endif /* GL_ARB_pixel_buffer_object */ + +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 +#endif /* GL_ARB_polygon_offset_clamp */ + +#ifndef GL_ARB_post_depth_coverage +#define GL_ARB_post_depth_coverage 1 +#endif /* GL_ARB_post_depth_coverage */ + +#ifndef GL_ARB_program_interface_query +#define GL_ARB_program_interface_query 1 +#endif /* GL_ARB_program_interface_query */ + +#ifndef GL_ARB_provoking_vertex +#define GL_ARB_provoking_vertex 1 +#endif /* GL_ARB_provoking_vertex */ + +#ifndef GL_ARB_query_buffer_object +#define GL_ARB_query_buffer_object 1 +#endif /* GL_ARB_query_buffer_object */ + +#ifndef GL_ARB_robust_buffer_access_behavior +#define GL_ARB_robust_buffer_access_behavior 1 +#endif /* GL_ARB_robust_buffer_access_behavior */ + +#ifndef GL_ARB_robustness +#define GL_ARB_robustness 1 +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT_ARB 0x00000004 +#define GL_LOSE_CONTEXT_ON_RESET_ARB 0x8252 +#define GL_GUILTY_CONTEXT_RESET_ARB 0x8253 +#define GL_INNOCENT_CONTEXT_RESET_ARB 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET_ARB 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 +#define GL_NO_RESET_NOTIFICATION_ARB 0x8261 +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSARBPROC) (void); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, void *img); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLenum APIENTRY glGetGraphicsResetStatusARB (void); +GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, void *img); +GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, void *data); +GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, void *img); +GLAPI void APIENTRY glGetnUniformfvARB (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformivARB (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuivARB (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glGetnUniformdvARB (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +#endif +#endif /* GL_ARB_robustness */ + +#ifndef GL_ARB_robustness_isolation +#define GL_ARB_robustness_isolation 1 +#endif /* GL_ARB_robustness_isolation */ + +#ifndef GL_ARB_sample_locations +#define GL_ARB_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_ARB 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_ARB 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_ARB 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_ARB 0x9340 +#define GL_SAMPLE_LOCATION_ARB 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_ARB 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_ARB 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_ARB 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVARBPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLEVALUATEDEPTHVALUESARBPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvARB (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvARB (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glEvaluateDepthValuesARB (void); +#endif +#endif /* GL_ARB_sample_locations */ + +#ifndef GL_ARB_sample_shading +#define GL_ARB_sample_shading 1 +#define GL_SAMPLE_SHADING_ARB 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE_ARB 0x8C37 +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGARBPROC) (GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShadingARB (GLfloat value); +#endif +#endif /* GL_ARB_sample_shading */ + +#ifndef GL_ARB_sampler_objects +#define GL_ARB_sampler_objects 1 +#endif /* GL_ARB_sampler_objects */ + +#ifndef GL_ARB_seamless_cube_map +#define GL_ARB_seamless_cube_map 1 +#endif /* GL_ARB_seamless_cube_map */ + +#ifndef GL_ARB_seamless_cubemap_per_texture +#define GL_ARB_seamless_cubemap_per_texture 1 +#endif /* GL_ARB_seamless_cubemap_per_texture */ + +#ifndef GL_ARB_separate_shader_objects +#define GL_ARB_separate_shader_objects 1 +#endif /* GL_ARB_separate_shader_objects */ + +#ifndef GL_ARB_shader_atomic_counter_ops +#define GL_ARB_shader_atomic_counter_ops 1 +#endif /* GL_ARB_shader_atomic_counter_ops */ + +#ifndef GL_ARB_shader_atomic_counters +#define GL_ARB_shader_atomic_counters 1 +#endif /* GL_ARB_shader_atomic_counters */ + +#ifndef GL_ARB_shader_ballot +#define GL_ARB_shader_ballot 1 +#endif /* GL_ARB_shader_ballot */ + +#ifndef GL_ARB_shader_bit_encoding +#define GL_ARB_shader_bit_encoding 1 +#endif /* GL_ARB_shader_bit_encoding */ + +#ifndef GL_ARB_shader_clock +#define GL_ARB_shader_clock 1 +#endif /* GL_ARB_shader_clock */ + +#ifndef GL_ARB_shader_draw_parameters +#define GL_ARB_shader_draw_parameters 1 +#endif /* GL_ARB_shader_draw_parameters */ + +#ifndef GL_ARB_shader_group_vote +#define GL_ARB_shader_group_vote 1 +#endif /* GL_ARB_shader_group_vote */ + +#ifndef GL_ARB_shader_image_load_store +#define GL_ARB_shader_image_load_store 1 +#endif /* GL_ARB_shader_image_load_store */ + +#ifndef GL_ARB_shader_image_size +#define GL_ARB_shader_image_size 1 +#endif /* GL_ARB_shader_image_size */ + +#ifndef GL_ARB_shader_precision +#define GL_ARB_shader_precision 1 +#endif /* GL_ARB_shader_precision */ + +#ifndef GL_ARB_shader_stencil_export +#define GL_ARB_shader_stencil_export 1 +#endif /* GL_ARB_shader_stencil_export */ + +#ifndef GL_ARB_shader_storage_buffer_object +#define GL_ARB_shader_storage_buffer_object 1 +#endif /* GL_ARB_shader_storage_buffer_object */ + +#ifndef GL_ARB_shader_subroutine +#define GL_ARB_shader_subroutine 1 +#endif /* GL_ARB_shader_subroutine */ + +#ifndef GL_ARB_shader_texture_image_samples +#define GL_ARB_shader_texture_image_samples 1 +#endif /* GL_ARB_shader_texture_image_samples */ + +#ifndef GL_ARB_shader_viewport_layer_array +#define GL_ARB_shader_viewport_layer_array 1 +#endif /* GL_ARB_shader_viewport_layer_array */ + +#ifndef GL_ARB_shading_language_420pack +#define GL_ARB_shading_language_420pack 1 +#endif /* GL_ARB_shading_language_420pack */ + +#ifndef GL_ARB_shading_language_include +#define GL_ARB_shading_language_include 1 +#define GL_SHADER_INCLUDE_ARB 0x8DAE +#define GL_NAMED_STRING_LENGTH_ARB 0x8DE9 +#define GL_NAMED_STRING_TYPE_ARB 0x8DEA +typedef void (APIENTRYP PFNGLNAMEDSTRINGARBPROC) (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +typedef void (APIENTRYP PFNGLDELETENAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERINCLUDEARBPROC) (GLuint shader, GLsizei count, const GLchar *const*path, const GLint *length); +typedef GLboolean (APIENTRYP PFNGLISNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGIVARBPROC) (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glNamedStringARB (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +GLAPI void APIENTRY glDeleteNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glCompileShaderIncludeARB (GLuint shader, GLsizei count, const GLchar *const*path, const GLint *length); +GLAPI GLboolean APIENTRY glIsNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glGetNamedStringARB (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#endif +#endif /* GL_ARB_shading_language_include */ + +#ifndef GL_ARB_shading_language_packing +#define GL_ARB_shading_language_packing 1 +#endif /* GL_ARB_shading_language_packing */ + +#ifndef GL_ARB_sparse_buffer +#define GL_ARB_sparse_buffer 1 +#define GL_SPARSE_STORAGE_BIT_ARB 0x0400 +#define GL_SPARSE_BUFFER_PAGE_SIZE_ARB 0x82F8 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTARBPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTARBPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentARB (GLenum target, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentARB (GLuint buffer, GLintptr offset, GLsizeiptr size, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_buffer */ + +#ifndef GL_ARB_sparse_texture +#define GL_ARB_sparse_texture 1 +#define GL_TEXTURE_SPARSE_ARB 0x91A6 +#define GL_VIRTUAL_PAGE_SIZE_INDEX_ARB 0x91A7 +#define GL_NUM_SPARSE_LEVELS_ARB 0x91AA +#define GL_NUM_VIRTUAL_PAGE_SIZES_ARB 0x91A8 +#define GL_VIRTUAL_PAGE_SIZE_X_ARB 0x9195 +#define GL_VIRTUAL_PAGE_SIZE_Y_ARB 0x9196 +#define GL_VIRTUAL_PAGE_SIZE_Z_ARB 0x9197 +#define GL_MAX_SPARSE_TEXTURE_SIZE_ARB 0x9198 +#define GL_MAX_SPARSE_3D_TEXTURE_SIZE_ARB 0x9199 +#define GL_MAX_SPARSE_ARRAY_TEXTURE_LAYERS_ARB 0x919A +#define GL_SPARSE_TEXTURE_FULL_ARRAY_CUBE_MIPMAPS_ARB 0x91A9 +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +#endif +#endif /* GL_ARB_sparse_texture */ + +#ifndef GL_ARB_sparse_texture2 +#define GL_ARB_sparse_texture2 1 +#endif /* GL_ARB_sparse_texture2 */ + +#ifndef GL_ARB_sparse_texture_clamp +#define GL_ARB_sparse_texture_clamp 1 +#endif /* GL_ARB_sparse_texture_clamp */ + +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 +#endif /* GL_ARB_spirv_extensions */ + +#ifndef GL_ARB_stencil_texturing +#define GL_ARB_stencil_texturing 1 +#endif /* GL_ARB_stencil_texturing */ + +#ifndef GL_ARB_sync +#define GL_ARB_sync 1 +#endif /* GL_ARB_sync */ + +#ifndef GL_ARB_tessellation_shader +#define GL_ARB_tessellation_shader 1 +#endif /* GL_ARB_tessellation_shader */ + +#ifndef GL_ARB_texture_barrier +#define GL_ARB_texture_barrier 1 +#endif /* GL_ARB_texture_barrier */ + +#ifndef GL_ARB_texture_border_clamp +#define GL_ARB_texture_border_clamp 1 +#define GL_CLAMP_TO_BORDER_ARB 0x812D +#endif /* GL_ARB_texture_border_clamp */ + +#ifndef GL_ARB_texture_buffer_object +#define GL_ARB_texture_buffer_object 1 +#define GL_TEXTURE_BUFFER_ARB 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_ARB 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_ARB 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_ARB 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT_ARB 0x8C2E +typedef void (APIENTRYP PFNGLTEXBUFFERARBPROC) (GLenum target, GLenum internalformat, GLuint buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBufferARB (GLenum target, GLenum internalformat, GLuint buffer); +#endif +#endif /* GL_ARB_texture_buffer_object */ + +#ifndef GL_ARB_texture_buffer_object_rgb32 +#define GL_ARB_texture_buffer_object_rgb32 1 +#endif /* GL_ARB_texture_buffer_object_rgb32 */ + +#ifndef GL_ARB_texture_buffer_range +#define GL_ARB_texture_buffer_range 1 +#endif /* GL_ARB_texture_buffer_range */ + +#ifndef GL_ARB_texture_compression_bptc +#define GL_ARB_texture_compression_bptc 1 +#define GL_COMPRESSED_RGBA_BPTC_UNORM_ARB 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_ARB 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_ARB 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_ARB 0x8E8F +#endif /* GL_ARB_texture_compression_bptc */ + +#ifndef GL_ARB_texture_compression_rgtc +#define GL_ARB_texture_compression_rgtc 1 +#endif /* GL_ARB_texture_compression_rgtc */ + +#ifndef GL_ARB_texture_cube_map_array +#define GL_ARB_texture_cube_map_array 1 +#define GL_TEXTURE_CUBE_MAP_ARRAY_ARB 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_ARB 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY_ARB 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_ARB 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900F +#endif /* GL_ARB_texture_cube_map_array */ + +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 +#endif /* GL_ARB_texture_filter_anisotropic */ + +#ifndef GL_ARB_texture_filter_minmax +#define GL_ARB_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 +#define GL_WEIGHTED_AVERAGE_ARB 0x9367 +#endif /* GL_ARB_texture_filter_minmax */ + +#ifndef GL_ARB_texture_gather +#define GL_ARB_texture_gather 1 +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5F +#define GL_MAX_PROGRAM_TEXTURE_GATHER_COMPONENTS_ARB 0x8F9F +#endif /* GL_ARB_texture_gather */ + +#ifndef GL_ARB_texture_mirror_clamp_to_edge +#define GL_ARB_texture_mirror_clamp_to_edge 1 +#endif /* GL_ARB_texture_mirror_clamp_to_edge */ + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_ARB_texture_mirrored_repeat 1 +#define GL_MIRRORED_REPEAT_ARB 0x8370 +#endif /* GL_ARB_texture_mirrored_repeat */ + +#ifndef GL_ARB_texture_multisample +#define GL_ARB_texture_multisample 1 +#endif /* GL_ARB_texture_multisample */ + +#ifndef GL_ARB_texture_non_power_of_two +#define GL_ARB_texture_non_power_of_two 1 +#endif /* GL_ARB_texture_non_power_of_two */ + +#ifndef GL_ARB_texture_query_levels +#define GL_ARB_texture_query_levels 1 +#endif /* GL_ARB_texture_query_levels */ + +#ifndef GL_ARB_texture_query_lod +#define GL_ARB_texture_query_lod 1 +#endif /* GL_ARB_texture_query_lod */ + +#ifndef GL_ARB_texture_rg +#define GL_ARB_texture_rg 1 +#endif /* GL_ARB_texture_rg */ + +#ifndef GL_ARB_texture_rgb10_a2ui +#define GL_ARB_texture_rgb10_a2ui 1 +#endif /* GL_ARB_texture_rgb10_a2ui */ + +#ifndef GL_ARB_texture_stencil8 +#define GL_ARB_texture_stencil8 1 +#endif /* GL_ARB_texture_stencil8 */ + +#ifndef GL_ARB_texture_storage +#define GL_ARB_texture_storage 1 +#endif /* GL_ARB_texture_storage */ + +#ifndef GL_ARB_texture_storage_multisample +#define GL_ARB_texture_storage_multisample 1 +#endif /* GL_ARB_texture_storage_multisample */ + +#ifndef GL_ARB_texture_swizzle +#define GL_ARB_texture_swizzle 1 +#endif /* GL_ARB_texture_swizzle */ + +#ifndef GL_ARB_texture_view +#define GL_ARB_texture_view 1 +#endif /* GL_ARB_texture_view */ + +#ifndef GL_ARB_timer_query +#define GL_ARB_timer_query 1 +#endif /* GL_ARB_timer_query */ + +#ifndef GL_ARB_transform_feedback2 +#define GL_ARB_transform_feedback2 1 +#endif /* GL_ARB_transform_feedback2 */ + +#ifndef GL_ARB_transform_feedback3 +#define GL_ARB_transform_feedback3 1 +#endif /* GL_ARB_transform_feedback3 */ + +#ifndef GL_ARB_transform_feedback_instanced +#define GL_ARB_transform_feedback_instanced 1 +#endif /* GL_ARB_transform_feedback_instanced */ + +#ifndef GL_ARB_transform_feedback_overflow_query +#define GL_ARB_transform_feedback_overflow_query 1 +#define GL_TRANSFORM_FEEDBACK_OVERFLOW_ARB 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW_ARB 0x82ED +#endif /* GL_ARB_transform_feedback_overflow_query */ + +#ifndef GL_ARB_uniform_buffer_object +#define GL_ARB_uniform_buffer_object 1 +#endif /* GL_ARB_uniform_buffer_object */ + +#ifndef GL_ARB_vertex_array_bgra +#define GL_ARB_vertex_array_bgra 1 +#endif /* GL_ARB_vertex_array_bgra */ + +#ifndef GL_ARB_vertex_array_object +#define GL_ARB_vertex_array_object 1 +#endif /* GL_ARB_vertex_array_object */ + +#ifndef GL_ARB_vertex_attrib_64bit +#define GL_ARB_vertex_attrib_64bit 1 +#endif /* GL_ARB_vertex_attrib_64bit */ + +#ifndef GL_ARB_vertex_attrib_binding +#define GL_ARB_vertex_attrib_binding 1 +#endif /* GL_ARB_vertex_attrib_binding */ + +#ifndef GL_ARB_vertex_type_10f_11f_11f_rev +#define GL_ARB_vertex_type_10f_11f_11f_rev 1 +#endif /* GL_ARB_vertex_type_10f_11f_11f_rev */ + +#ifndef GL_ARB_vertex_type_2_10_10_10_rev +#define GL_ARB_vertex_type_2_10_10_10_rev 1 +#endif /* GL_ARB_vertex_type_2_10_10_10_rev */ + +#ifndef GL_ARB_viewport_array +#define GL_ARB_viewport_array 1 +typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYDVNVPROC) (GLuint first, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDDNVPROC) (GLuint index, GLdouble n, GLdouble f); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthRangeArraydvNV (GLuint first, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glDepthRangeIndexeddNV (GLuint index, GLdouble n, GLdouble f); +#endif +#endif /* GL_ARB_viewport_array */ + +#ifndef GL_KHR_blend_equation_advanced +#define GL_KHR_blend_equation_advanced 1 +#define GL_MULTIPLY_KHR 0x9294 +#define GL_SCREEN_KHR 0x9295 +#define GL_OVERLAY_KHR 0x9296 +#define GL_DARKEN_KHR 0x9297 +#define GL_LIGHTEN_KHR 0x9298 +#define GL_COLORDODGE_KHR 0x9299 +#define GL_COLORBURN_KHR 0x929A +#define GL_HARDLIGHT_KHR 0x929B +#define GL_SOFTLIGHT_KHR 0x929C +#define GL_DIFFERENCE_KHR 0x929E +#define GL_EXCLUSION_KHR 0x92A0 +#define GL_HSL_HUE_KHR 0x92AD +#define GL_HSL_SATURATION_KHR 0x92AE +#define GL_HSL_COLOR_KHR 0x92AF +#define GL_HSL_LUMINOSITY_KHR 0x92B0 +typedef void (APIENTRYP PFNGLBLENDBARRIERKHRPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendBarrierKHR (void); +#endif +#endif /* GL_KHR_blend_equation_advanced */ + +#ifndef GL_KHR_blend_equation_advanced_coherent +#define GL_KHR_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_KHR 0x9285 +#endif /* GL_KHR_blend_equation_advanced_coherent */ + +#ifndef GL_KHR_context_flush_control +#define GL_KHR_context_flush_control 1 +#endif /* GL_KHR_context_flush_control */ + +#ifndef GL_KHR_debug +#define GL_KHR_debug 1 +#endif /* GL_KHR_debug */ + +#ifndef GL_KHR_no_error +#define GL_KHR_no_error 1 +#define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 +#endif /* GL_KHR_no_error */ + +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + +#ifndef GL_KHR_robust_buffer_access_behavior +#define GL_KHR_robust_buffer_access_behavior 1 +#endif /* GL_KHR_robust_buffer_access_behavior */ + +#ifndef GL_KHR_robustness +#define GL_KHR_robustness 1 +#define GL_CONTEXT_ROBUST_ACCESS 0x90F3 +#endif /* GL_KHR_robustness */ + +#ifndef GL_KHR_shader_subgroup +#define GL_KHR_shader_subgroup 1 +#define GL_SUBGROUP_SIZE_KHR 0x9532 +#define GL_SUBGROUP_SUPPORTED_STAGES_KHR 0x9533 +#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534 +#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR 0x9535 +#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001 +#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR 0x00000002 +#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004 +#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008 +#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010 +#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020 +#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040 +#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR 0x00000080 +#endif /* GL_KHR_shader_subgroup */ + +#ifndef GL_KHR_texture_compression_astc_hdr +#define GL_KHR_texture_compression_astc_hdr 1 +#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 +#define GL_COMPRESSED_RGBA_ASTC_5x4_KHR 0x93B1 +#define GL_COMPRESSED_RGBA_ASTC_5x5_KHR 0x93B2 +#define GL_COMPRESSED_RGBA_ASTC_6x5_KHR 0x93B3 +#define GL_COMPRESSED_RGBA_ASTC_6x6_KHR 0x93B4 +#define GL_COMPRESSED_RGBA_ASTC_8x5_KHR 0x93B5 +#define GL_COMPRESSED_RGBA_ASTC_8x6_KHR 0x93B6 +#define GL_COMPRESSED_RGBA_ASTC_8x8_KHR 0x93B7 +#define GL_COMPRESSED_RGBA_ASTC_10x5_KHR 0x93B8 +#define GL_COMPRESSED_RGBA_ASTC_10x6_KHR 0x93B9 +#define GL_COMPRESSED_RGBA_ASTC_10x8_KHR 0x93BA +#define GL_COMPRESSED_RGBA_ASTC_10x10_KHR 0x93BB +#define GL_COMPRESSED_RGBA_ASTC_12x10_KHR 0x93BC +#define GL_COMPRESSED_RGBA_ASTC_12x12_KHR 0x93BD +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4_KHR 0x93D0 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x4_KHR 0x93D1 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_5x5_KHR 0x93D2 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x5_KHR 0x93D3 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_6x6_KHR 0x93D4 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x5_KHR 0x93D5 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x6_KHR 0x93D6 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_8x8_KHR 0x93D7 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x5_KHR 0x93D8 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x6_KHR 0x93D9 +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x8_KHR 0x93DA +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_10x10_KHR 0x93DB +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x10_KHR 0x93DC +#define GL_COMPRESSED_SRGB8_ALPHA8_ASTC_12x12_KHR 0x93DD +#endif /* GL_KHR_texture_compression_astc_hdr */ + +#ifndef GL_KHR_texture_compression_astc_ldr +#define GL_KHR_texture_compression_astc_ldr 1 +#endif /* GL_KHR_texture_compression_astc_ldr */ + +#ifndef GL_KHR_texture_compression_astc_sliced_3d +#define GL_KHR_texture_compression_astc_sliced_3d 1 +#endif /* GL_KHR_texture_compression_astc_sliced_3d */ + +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + +#ifndef GL_AMD_performance_monitor +#define GL_AMD_performance_monitor 1 +#define GL_COUNTER_TYPE_AMD 0x8BC0 +#define GL_COUNTER_RANGE_AMD 0x8BC1 +#define GL_UNSIGNED_INT64_AMD 0x8BC2 +#define GL_PERCENTAGE_AMD 0x8BC3 +#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 +#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 +#define GL_PERFMON_RESULT_AMD 0x8BC6 +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, void *data); +typedef void (APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +typedef void (APIENTRYP PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +GLAPI void APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +GLAPI void APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +GLAPI void APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, void *data); +GLAPI void APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +GLAPI void APIENTRY glBeginPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glEndPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#endif +#endif /* GL_AMD_performance_monitor */ + +#ifndef GL_APPLE_rgb_422 +#define GL_APPLE_rgb_422 1 +#define GL_RGB_422_APPLE 0x8A1F +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#define GL_RGB_RAW_422_APPLE 0x8A51 +#endif /* GL_APPLE_rgb_422 */ + +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void *GLeglImageOES; +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + +#ifndef GL_EXT_EGL_sync +#define GL_EXT_EGL_sync 1 +#endif /* GL_EXT_EGL_sync */ + +#ifndef GL_EXT_debug_label +#define GL_EXT_debug_label 1 +#define GL_PROGRAM_PIPELINE_OBJECT_EXT 0x8A4F +#define GL_PROGRAM_OBJECT_EXT 0x8B40 +#define GL_SHADER_OBJECT_EXT 0x8B48 +#define GL_BUFFER_OBJECT_EXT 0x9151 +#define GL_QUERY_OBJECT_EXT 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_EXT 0x9154 +typedef void (APIENTRYP PFNGLLABELOBJECTEXTPROC) (GLenum type, GLuint object, GLsizei length, const GLchar *label); +typedef void (APIENTRYP PFNGLGETOBJECTLABELEXTPROC) (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLabelObjectEXT (GLenum type, GLuint object, GLsizei length, const GLchar *label); +GLAPI void APIENTRY glGetObjectLabelEXT (GLenum type, GLuint object, GLsizei bufSize, GLsizei *length, GLchar *label); +#endif +#endif /* GL_EXT_debug_label */ + +#ifndef GL_EXT_debug_marker +#define GL_EXT_debug_marker 1 +typedef void (APIENTRYP PFNGLINSERTEVENTMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPUSHGROUPMARKEREXTPROC) (GLsizei length, const GLchar *marker); +typedef void (APIENTRYP PFNGLPOPGROUPMARKEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glInsertEventMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPushGroupMarkerEXT (GLsizei length, const GLchar *marker); +GLAPI void APIENTRY glPopGroupMarkerEXT (void); +#endif +#endif /* GL_EXT_debug_marker */ + +#ifndef GL_EXT_direct_state_access +#define GL_EXT_direct_state_access 1 +#define GL_PROGRAM_MATRIX_EXT 0x8E2D +#define GL_TRANSPOSE_PROGRAM_MATRIX_EXT 0x8E2E +#define GL_PROGRAM_MATRIX_STACK_DEPTH_EXT 0x8E2F +typedef void (APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLPUSHCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); +typedef void (APIENTRYP PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXGENDEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +typedef void (APIENTRYP PFNGLMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +typedef void (APIENTRYP PFNGLMULTITEXGENFEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXGENIEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble *data); +typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, void **data); +typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, void *img); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, void **params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLTEXTUREBUFFEREXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLMULTITEXBUFFEREXTPROC) (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIEXTPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IEXTPROC) (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIUIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint *params); +typedef void (APIENTRYP PFNGLENABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEIEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLGETFLOATI_VEXTPROC) (GLenum pname, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETDOUBLEI_VEXTPROC) (GLenum pname, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPOINTERI_VEXTPROC) (GLenum pname, GLuint index, void **params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, void *string); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLECOVERAGEEXTPROC) (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSEXTPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE3DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPEXTPROC) (GLuint texture, GLenum target); +typedef void (APIENTRYP PFNGLGENERATEMULTITEXMIPMAPEXTPROC) (GLenum texunit, GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLFRAMEBUFFERREADBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYEREXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREFACEEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +typedef void (APIENTRYP PFNGLTEXTURERENDERBUFFEREXTPROC) (GLuint texture, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLMULTITEXRENDERBUFFEREXTPROC) (GLenum texunit, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYEDGEFLAGOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYINDEXOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYNORMALOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYTEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYMULTITEXCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYFOGCOORDOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYSECONDARYCOLOROFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBIOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYEXTPROC) (GLuint vaobj, GLenum array); +typedef void (APIENTRYP PFNGLENABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEVERTEXARRAYATTRIBEXTPROC) (GLuint vaobj, GLuint index); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERVEXTPROC) (GLuint vaobj, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERVEXTPROC) (GLuint vaobj, GLenum pname, void **param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYINTEGERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETVERTEXARRAYPOINTERI_VEXTPROC) (GLuint vaobj, GLuint index, GLenum pname, void **param); +typedef void *(APIENTRYP PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTPROC) (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLCLEARNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERPARAMETERIEXTPROC) (GLuint framebuffer, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DEXTPROC) (GLuint program, GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLTEXTUREBUFFERRANGEEXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE1DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DEXTPROC) (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE2DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXTURESTORAGE3DMULTISAMPLEEXTPROC) (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLVERTEXARRAYBINDVERTEXBUFFEREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBIFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLFORMATEXTPROC) (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBBINDINGEXTPROC) (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXBINDINGDIVISOREXTPROC) (GLuint vaobj, GLuint bindingindex, GLuint divisor); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTEXTPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBDIVISOREXTPROC) (GLuint vaobj, GLuint index, GLuint divisor); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GLAPI void APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixPopEXT (GLenum mode); +GLAPI void APIENTRY glMatrixPushEXT (GLenum mode); +GLAPI void APIENTRY glClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glPushClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glTextureParameterfEXT (GLuint texture, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glTextureParameteriEXT (GLuint texture, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureLevelParameterfvEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameterivEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glBindMultiTextureEXT (GLenum texunit, GLenum target, GLuint texture); +GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const void *pointer); +GLAPI void APIENTRY glMultiTexEnvfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexEnviEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexGendEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +GLAPI void APIENTRY glMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +GLAPI void APIENTRY glMultiTexGenfEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexGeniEXT (GLenum texunit, GLenum coord, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +GLAPI void APIENTRY glMultiTexParameteriEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexParameterfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, void *pixels); +GLAPI void APIENTRY glGetMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterfvEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterivEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *pixels); +GLAPI void APIENTRY glCopyMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glEnableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glDisableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glGetFloatIndexedvEXT (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoubleIndexedvEXT (GLenum target, GLuint index, GLdouble *data); +GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, void **data); +GLAPI void APIENTRY glEnableIndexedEXT (GLenum target, GLuint index); +GLAPI void APIENTRY glDisableIndexedEXT (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum target, GLuint index); +GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void *bits); +GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, void *img); +GLAPI void APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const void *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); +GLAPI void *APIENTRY glMapNamedBufferEXT (GLuint buffer, GLenum access); +GLAPI GLboolean APIENTRY glUnmapNamedBufferEXT (GLuint buffer); +GLAPI void APIENTRY glGetNamedBufferParameterivEXT (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, void **params); +GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, void *data); +GLAPI void APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform4fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform1iEXT (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform2iEXT (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform3iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform4iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform1fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glTextureBufferEXT (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glMultiTexBufferEXT (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glProgramUniform1uiEXT (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform2uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform3uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform4uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform1uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glNamedProgramLocalParameters4fvEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4iEXT (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4ivEXT (GLuint program, GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4ivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uiEXT (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uivEXT (GLuint program, GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4uivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIivEXT (GLuint program, GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIuivEXT (GLuint program, GLenum target, GLuint index, GLuint *params); +GLAPI void APIENTRY glEnableClientStateiEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glDisableClientStateiEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glGetFloati_vEXT (GLenum pname, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetDoublei_vEXT (GLenum pname, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetPointeri_vEXT (GLenum pname, GLuint index, void **params); +GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const void *string); +GLAPI void APIENTRY glNamedProgramLocalParameter4dEXT (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glNamedProgramLocalParameter4dvEXT (GLuint program, GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glNamedProgramLocalParameter4fEXT (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glNamedProgramLocalParameter4fvEXT (GLuint program, GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterdvEXT (GLuint program, GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterfvEXT (GLuint program, GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramivEXT (GLuint program, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, void *string); +GLAPI void APIENTRY glNamedRenderbufferStorageEXT (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameterivEXT (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleEXT (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleCoverageEXT (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatusEXT (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glNamedFramebufferTexture1DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture2DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture3DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glNamedFramebufferRenderbufferEXT (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameterivEXT (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateTextureMipmapEXT (GLuint texture, GLenum target); +GLAPI void APIENTRY glGenerateMultiTexMipmapEXT (GLenum texunit, GLenum target); +GLAPI void APIENTRY glFramebufferDrawBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glFramebufferDrawBuffersEXT (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glFramebufferReadBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glGetFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glNamedCopyBufferSubDataEXT (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glNamedFramebufferTextureEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayerEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferTextureFaceEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +GLAPI void APIENTRY glTextureRenderbufferEXT (GLuint texture, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glMultiTexRenderbufferEXT (GLenum texunit, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glVertexArrayVertexOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayColorOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayEdgeFlagOffsetEXT (GLuint vaobj, GLuint buffer, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayIndexOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayNormalOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayTexCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayMultiTexCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLenum texunit, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayFogCoordOffsetEXT (GLuint vaobj, GLuint buffer, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArraySecondaryColorOffsetEXT (GLuint vaobj, GLuint buffer, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayVertexAttribOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glVertexArrayVertexAttribIOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glEnableVertexArrayEXT (GLuint vaobj, GLenum array); +GLAPI void APIENTRY glDisableVertexArrayEXT (GLuint vaobj, GLenum array); +GLAPI void APIENTRY glEnableVertexArrayAttribEXT (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glDisableVertexArrayAttribEXT (GLuint vaobj, GLuint index); +GLAPI void APIENTRY glGetVertexArrayIntegervEXT (GLuint vaobj, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayPointervEXT (GLuint vaobj, GLenum pname, void **param); +GLAPI void APIENTRY glGetVertexArrayIntegeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, GLint *param); +GLAPI void APIENTRY glGetVertexArrayPointeri_vEXT (GLuint vaobj, GLuint index, GLenum pname, void **param); +GLAPI void *APIENTRY glMapNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glNamedBufferStorageEXT (GLuint buffer, GLsizeiptr size, const void *data, GLbitfield flags); +GLAPI void APIENTRY glClearNamedBufferDataEXT (GLuint buffer, GLenum internalformat, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glClearNamedBufferSubDataEXT (GLuint buffer, GLenum internalformat, GLsizeiptr offset, GLsizeiptr size, GLenum format, GLenum type, const void *data); +GLAPI void APIENTRY glNamedFramebufferParameteriEXT (GLuint framebuffer, GLenum pname, GLint param); +GLAPI void APIENTRY glGetNamedFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glProgramUniform1dEXT (GLuint program, GLint location, GLdouble x); +GLAPI void APIENTRY glProgramUniform2dEXT (GLuint program, GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glProgramUniform3dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glProgramUniform4dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramUniform1dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glTextureBufferRangeEXT (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glTextureStorage1DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTextureStorage2DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTextureStorage3DEXT (GLuint texture, GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +GLAPI void APIENTRY glTextureStorage2DMultisampleEXT (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTextureStorage3DMultisampleEXT (GLuint texture, GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glVertexArrayBindVertexBufferEXT (GLuint vaobj, GLuint bindingindex, GLuint buffer, GLintptr offset, GLsizei stride); +GLAPI void APIENTRY glVertexArrayVertexAttribFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLboolean normalized, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribIFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribLFormatEXT (GLuint vaobj, GLuint attribindex, GLint size, GLenum type, GLuint relativeoffset); +GLAPI void APIENTRY glVertexArrayVertexAttribBindingEXT (GLuint vaobj, GLuint attribindex, GLuint bindingindex); +GLAPI void APIENTRY glVertexArrayVertexBindingDivisorEXT (GLuint vaobj, GLuint bindingindex, GLuint divisor); +GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +GLAPI void APIENTRY glTexturePageCommitmentEXT (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLboolean commit); +GLAPI void APIENTRY glVertexArrayVertexAttribDivisorEXT (GLuint vaobj, GLuint index, GLuint divisor); +#endif +#endif /* GL_EXT_direct_state_access */ + +#ifndef GL_EXT_draw_instanced +#define GL_EXT_draw_instanced 1 +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei primcount); +#endif +#endif /* GL_EXT_draw_instanced */ + +#ifndef GL_EXT_multiview_tessellation_geometry_shader +#define GL_EXT_multiview_tessellation_geometry_shader 1 +#endif /* GL_EXT_multiview_tessellation_geometry_shader */ + +#ifndef GL_EXT_multiview_texture_multisample +#define GL_EXT_multiview_texture_multisample 1 +#endif /* GL_EXT_multiview_texture_multisample */ + +#ifndef GL_EXT_multiview_timer_query +#define GL_EXT_multiview_timer_query 1 +#endif /* GL_EXT_multiview_timer_query */ + +#ifndef GL_EXT_polygon_offset_clamp +#define GL_EXT_polygon_offset_clamp 1 +#define GL_POLYGON_OFFSET_CLAMP_EXT 0x8E1B +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPEXTPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetClampEXT (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_EXT_polygon_offset_clamp */ + +#ifndef GL_EXT_post_depth_coverage +#define GL_EXT_post_depth_coverage 1 +#endif /* GL_EXT_post_depth_coverage */ + +#ifndef GL_EXT_raster_multisample +#define GL_EXT_raster_multisample 1 +#define GL_RASTER_MULTISAMPLE_EXT 0x9327 +#define GL_RASTER_SAMPLES_EXT 0x9328 +#define GL_MAX_RASTER_SAMPLES_EXT 0x9329 +#define GL_RASTER_FIXED_SAMPLE_LOCATIONS_EXT 0x932A +#define GL_MULTISAMPLE_RASTERIZATION_ALLOWED_EXT 0x932B +#define GL_EFFECTIVE_RASTER_SAMPLES_EXT 0x932C +typedef void (APIENTRYP PFNGLRASTERSAMPLESEXTPROC) (GLuint samples, GLboolean fixedsamplelocations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRasterSamplesEXT (GLuint samples, GLboolean fixedsamplelocations); +#endif +#endif /* GL_EXT_raster_multisample */ + +#ifndef GL_EXT_separate_shader_objects +#define GL_EXT_separate_shader_objects 1 +#define GL_ACTIVE_PROGRAM_EXT 0x8B8D +typedef void (APIENTRYP PFNGLUSESHADERPROGRAMEXTPROC) (GLenum type, GLuint program); +typedef void (APIENTRYP PFNGLACTIVEPROGRAMEXTPROC) (GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMEXTPROC) (GLenum type, const GLchar *string); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUseShaderProgramEXT (GLenum type, GLuint program); +GLAPI void APIENTRY glActiveProgramEXT (GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *string); +#endif +#endif /* GL_EXT_separate_shader_objects */ + +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + +#ifndef GL_EXT_shader_integer_mix +#define GL_EXT_shader_integer_mix 1 +#endif /* GL_EXT_shader_integer_mix */ + +#ifndef GL_EXT_texture_compression_s3tc +#define GL_EXT_texture_compression_s3tc 1 +#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 +#endif /* GL_EXT_texture_compression_s3tc */ + +#ifndef GL_EXT_texture_filter_minmax +#define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 +#endif /* GL_EXT_texture_filter_minmax */ + +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 +#define GL_SR8_EXT 0x8FBD +#endif /* GL_EXT_texture_sRGB_R8 */ + +#ifndef GL_EXT_texture_sRGB_RG8 +#define GL_EXT_texture_sRGB_RG8 1 +#define GL_SRG8_EXT 0x8FBE +#endif /* GL_EXT_texture_sRGB_RG8 */ + +#ifndef GL_EXT_texture_sRGB_decode +#define GL_EXT_texture_sRGB_decode 1 +#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 +#define GL_DECODE_EXT 0x8A49 +#define GL_SKIP_DECODE_EXT 0x8A4A +#endif /* GL_EXT_texture_sRGB_decode */ + +#ifndef GL_EXT_texture_shadow_lod +#define GL_EXT_texture_shadow_lod 1 +#endif /* GL_EXT_texture_shadow_lod */ + +#ifndef GL_EXT_texture_storage +#define GL_EXT_texture_storage 1 +#define GL_TEXTURE_IMMUTABLE_FORMAT_EXT 0x912F +#define GL_ALPHA8_EXT 0x803C +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_RGBA32F_EXT 0x8814 +#define GL_RGB32F_EXT 0x8815 +#define GL_ALPHA32F_EXT 0x8816 +#define GL_LUMINANCE32F_EXT 0x8818 +#define GL_LUMINANCE_ALPHA32F_EXT 0x8819 +#define GL_RGBA16F_EXT 0x881A +#define GL_RGB16F_EXT 0x881B +#define GL_ALPHA16F_EXT 0x881C +#define GL_LUMINANCE16F_EXT 0x881E +#define GL_LUMINANCE_ALPHA16F_EXT 0x881F +#define GL_RGB10_A2_EXT 0x8059 +#define GL_RGB10_EXT 0x8052 +#define GL_BGRA8_EXT 0x93A1 +#define GL_R8_EXT 0x8229 +#define GL_RG8_EXT 0x822B +#define GL_R32F_EXT 0x822E +#define GL_RG32F_EXT 0x8230 +#define GL_R16F_EXT 0x822D +#define GL_RG16F_EXT 0x822F +typedef void (APIENTRYP PFNGLTEXSTORAGE1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +typedef void (APIENTRYP PFNGLTEXSTORAGE2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLTEXSTORAGE3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexStorage1DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width); +GLAPI void APIENTRY glTexStorage2DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glTexStorage3DEXT (GLenum target, GLsizei levels, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth); +#endif +#endif /* GL_EXT_texture_storage */ + +#ifndef GL_EXT_window_rectangles +#define GL_EXT_window_rectangles 1 +#define GL_INCLUSIVE_EXT 0x8F10 +#define GL_EXCLUSIVE_EXT 0x8F11 +#define GL_WINDOW_RECTANGLE_EXT 0x8F12 +#define GL_WINDOW_RECTANGLE_MODE_EXT 0x8F13 +#define GL_MAX_WINDOW_RECTANGLES_EXT 0x8F14 +#define GL_NUM_WINDOW_RECTANGLES_EXT 0x8F15 +typedef void (APIENTRYP PFNGLWINDOWRECTANGLESEXTPROC) (GLenum mode, GLsizei count, const GLint *box); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowRectanglesEXT (GLenum mode, GLsizei count, const GLint *box); +#endif +#endif /* GL_EXT_window_rectangles */ + +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + +#ifndef GL_INTEL_conservative_rasterization +#define GL_INTEL_conservative_rasterization 1 +#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE +#endif /* GL_INTEL_conservative_rasterization */ + +#ifndef GL_INTEL_framebuffer_CMAA +#define GL_INTEL_framebuffer_CMAA 1 +typedef void (APIENTRYP PFNGLAPPLYFRAMEBUFFERATTACHMENTCMAAINTELPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyFramebufferAttachmentCMAAINTEL (void); +#endif +#endif /* GL_INTEL_framebuffer_CMAA */ + +#ifndef GL_INTEL_performance_query +#define GL_INTEL_performance_query 1 +#define GL_PERFQUERY_SINGLE_CONTEXT_INTEL 0x00000000 +#define GL_PERFQUERY_GLOBAL_CONTEXT_INTEL 0x00000001 +#define GL_PERFQUERY_WAIT_INTEL 0x83FB +#define GL_PERFQUERY_FLUSH_INTEL 0x83FA +#define GL_PERFQUERY_DONOT_FLUSH_INTEL 0x83F9 +#define GL_PERFQUERY_COUNTER_EVENT_INTEL 0x94F0 +#define GL_PERFQUERY_COUNTER_DURATION_NORM_INTEL 0x94F1 +#define GL_PERFQUERY_COUNTER_DURATION_RAW_INTEL 0x94F2 +#define GL_PERFQUERY_COUNTER_THROUGHPUT_INTEL 0x94F3 +#define GL_PERFQUERY_COUNTER_RAW_INTEL 0x94F4 +#define GL_PERFQUERY_COUNTER_TIMESTAMP_INTEL 0x94F5 +#define GL_PERFQUERY_COUNTER_DATA_UINT32_INTEL 0x94F8 +#define GL_PERFQUERY_COUNTER_DATA_UINT64_INTEL 0x94F9 +#define GL_PERFQUERY_COUNTER_DATA_FLOAT_INTEL 0x94FA +#define GL_PERFQUERY_COUNTER_DATA_DOUBLE_INTEL 0x94FB +#define GL_PERFQUERY_COUNTER_DATA_BOOL32_INTEL 0x94FC +#define GL_PERFQUERY_QUERY_NAME_LENGTH_MAX_INTEL 0x94FD +#define GL_PERFQUERY_COUNTER_NAME_LENGTH_MAX_INTEL 0x94FE +#define GL_PERFQUERY_COUNTER_DESC_LENGTH_MAX_INTEL 0x94FF +#define GL_PERFQUERY_GPA_EXTENDED_COUNTERS_INTEL 0x9500 +typedef void (APIENTRYP PFNGLBEGINPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLCREATEPERFQUERYINTELPROC) (GLuint queryId, GLuint *queryHandle); +typedef void (APIENTRYP PFNGLDELETEPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); +typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); +typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); +typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); +typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glCreatePerfQueryINTEL (GLuint queryId, GLuint *queryHandle); +GLAPI void APIENTRY glDeletePerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); +GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); +GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); +GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); +GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); +#endif +#endif /* GL_INTEL_performance_query */ + +#ifndef GL_MESA_framebuffer_flip_x +#define GL_MESA_framebuffer_flip_x 1 +#define GL_FRAMEBUFFER_FLIP_X_MESA 0x8BBC +#endif /* GL_MESA_framebuffer_flip_x */ + +#ifndef GL_MESA_framebuffer_flip_y +#define GL_MESA_framebuffer_flip_y 1 +#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB +typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params); +#endif +#endif /* GL_MESA_framebuffer_flip_y */ + +#ifndef GL_MESA_framebuffer_swap_xy +#define GL_MESA_framebuffer_swap_xy 1 +#define GL_FRAMEBUFFER_SWAP_XY_MESA 0x8BBD +#endif /* GL_MESA_framebuffer_swap_xy */ + +#ifndef GL_NV_bindless_multi_draw_indirect +#define GL_NV_bindless_multi_draw_indirect 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect */ + +#ifndef GL_NV_bindless_multi_draw_indirect_count +#define GL_NV_bindless_multi_draw_indirect_count 1 +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTBINDLESSCOUNTNVPROC) (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysIndirectBindlessCountNV (GLenum mode, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +GLAPI void APIENTRY glMultiDrawElementsIndirectBindlessCountNV (GLenum mode, GLenum type, const void *indirect, GLsizei drawCount, GLsizei maxDrawCount, GLsizei stride, GLint vertexBufferCount); +#endif +#endif /* GL_NV_bindless_multi_draw_indirect_count */ + +#ifndef GL_NV_bindless_texture +#define GL_NV_bindless_texture 1 +typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLENVPROC) (GLuint texture); +typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLENVPROC) (GLuint texture, GLuint sampler); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLMAKETEXTUREHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef GLuint64 (APIENTRYP PFNGLGETIMAGEHANDLENVPROC) (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle, GLenum access); +typedef void (APIENTRYP PFNGLMAKEIMAGEHANDLENONRESIDENTNVPROC) (GLuint64 handle); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64NVPROC) (GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLUNIFORMHANDLEUI64VNVPROC) (GLint location, GLsizei count, const GLuint64 *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64NVPROC) (GLuint program, GLint location, GLuint64 value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMHANDLEUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREHANDLERESIDENTNVPROC) (GLuint64 handle); +typedef GLboolean (APIENTRYP PFNGLISIMAGEHANDLERESIDENTNVPROC) (GLuint64 handle); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint64 APIENTRY glGetTextureHandleNV (GLuint texture); +GLAPI GLuint64 APIENTRY glGetTextureSamplerHandleNV (GLuint texture, GLuint sampler); +GLAPI void APIENTRY glMakeTextureHandleResidentNV (GLuint64 handle); +GLAPI void APIENTRY glMakeTextureHandleNonResidentNV (GLuint64 handle); +GLAPI GLuint64 APIENTRY glGetImageHandleNV (GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum format); +GLAPI void APIENTRY glMakeImageHandleResidentNV (GLuint64 handle, GLenum access); +GLAPI void APIENTRY glMakeImageHandleNonResidentNV (GLuint64 handle); +GLAPI void APIENTRY glUniformHandleui64NV (GLint location, GLuint64 value); +GLAPI void APIENTRY glUniformHandleui64vNV (GLint location, GLsizei count, const GLuint64 *value); +GLAPI void APIENTRY glProgramUniformHandleui64NV (GLuint program, GLint location, GLuint64 value); +GLAPI void APIENTRY glProgramUniformHandleui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64 *values); +GLAPI GLboolean APIENTRY glIsTextureHandleResidentNV (GLuint64 handle); +GLAPI GLboolean APIENTRY glIsImageHandleResidentNV (GLuint64 handle); +#endif +#endif /* GL_NV_bindless_texture */ + +#ifndef GL_NV_blend_equation_advanced +#define GL_NV_blend_equation_advanced 1 +#define GL_BLEND_OVERLAP_NV 0x9281 +#define GL_BLEND_PREMULTIPLIED_SRC_NV 0x9280 +#define GL_BLUE_NV 0x1905 +#define GL_COLORBURN_NV 0x929A +#define GL_COLORDODGE_NV 0x9299 +#define GL_CONJOINT_NV 0x9284 +#define GL_CONTRAST_NV 0x92A1 +#define GL_DARKEN_NV 0x9297 +#define GL_DIFFERENCE_NV 0x929E +#define GL_DISJOINT_NV 0x9283 +#define GL_DST_ATOP_NV 0x928F +#define GL_DST_IN_NV 0x928B +#define GL_DST_NV 0x9287 +#define GL_DST_OUT_NV 0x928D +#define GL_DST_OVER_NV 0x9289 +#define GL_EXCLUSION_NV 0x92A0 +#define GL_GREEN_NV 0x1904 +#define GL_HARDLIGHT_NV 0x929B +#define GL_HARDMIX_NV 0x92A9 +#define GL_HSL_COLOR_NV 0x92AF +#define GL_HSL_HUE_NV 0x92AD +#define GL_HSL_LUMINOSITY_NV 0x92B0 +#define GL_HSL_SATURATION_NV 0x92AE +#define GL_INVERT_OVG_NV 0x92B4 +#define GL_INVERT_RGB_NV 0x92A3 +#define GL_LIGHTEN_NV 0x9298 +#define GL_LINEARBURN_NV 0x92A5 +#define GL_LINEARDODGE_NV 0x92A4 +#define GL_LINEARLIGHT_NV 0x92A7 +#define GL_MINUS_CLAMPED_NV 0x92B3 +#define GL_MINUS_NV 0x929F +#define GL_MULTIPLY_NV 0x9294 +#define GL_OVERLAY_NV 0x9296 +#define GL_PINLIGHT_NV 0x92A8 +#define GL_PLUS_CLAMPED_ALPHA_NV 0x92B2 +#define GL_PLUS_CLAMPED_NV 0x92B1 +#define GL_PLUS_DARKER_NV 0x9292 +#define GL_PLUS_NV 0x9291 +#define GL_RED_NV 0x1903 +#define GL_SCREEN_NV 0x9295 +#define GL_SOFTLIGHT_NV 0x929C +#define GL_SRC_ATOP_NV 0x928E +#define GL_SRC_IN_NV 0x928A +#define GL_SRC_NV 0x9286 +#define GL_SRC_OUT_NV 0x928C +#define GL_SRC_OVER_NV 0x9288 +#define GL_UNCORRELATED_NV 0x9282 +#define GL_VIVIDLIGHT_NV 0x92A6 +#define GL_XOR_NV 0x1506 +typedef void (APIENTRYP PFNGLBLENDPARAMETERINVPROC) (GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLBLENDBARRIERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendParameteriNV (GLenum pname, GLint value); +GLAPI void APIENTRY glBlendBarrierNV (void); +#endif +#endif /* GL_NV_blend_equation_advanced */ + +#ifndef GL_NV_blend_equation_advanced_coherent +#define GL_NV_blend_equation_advanced_coherent 1 +#define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 +#endif /* GL_NV_blend_equation_advanced_coherent */ + +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D +#endif /* GL_NV_blend_minmax_factor */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_command_list +#define GL_NV_command_list 1 +#define GL_TERMINATE_SEQUENCE_COMMAND_NV 0x0000 +#define GL_NOP_COMMAND_NV 0x0001 +#define GL_DRAW_ELEMENTS_COMMAND_NV 0x0002 +#define GL_DRAW_ARRAYS_COMMAND_NV 0x0003 +#define GL_DRAW_ELEMENTS_STRIP_COMMAND_NV 0x0004 +#define GL_DRAW_ARRAYS_STRIP_COMMAND_NV 0x0005 +#define GL_DRAW_ELEMENTS_INSTANCED_COMMAND_NV 0x0006 +#define GL_DRAW_ARRAYS_INSTANCED_COMMAND_NV 0x0007 +#define GL_ELEMENT_ADDRESS_COMMAND_NV 0x0008 +#define GL_ATTRIBUTE_ADDRESS_COMMAND_NV 0x0009 +#define GL_UNIFORM_ADDRESS_COMMAND_NV 0x000A +#define GL_BLEND_COLOR_COMMAND_NV 0x000B +#define GL_STENCIL_REF_COMMAND_NV 0x000C +#define GL_LINE_WIDTH_COMMAND_NV 0x000D +#define GL_POLYGON_OFFSET_COMMAND_NV 0x000E +#define GL_ALPHA_REF_COMMAND_NV 0x000F +#define GL_VIEWPORT_COMMAND_NV 0x0010 +#define GL_SCISSOR_COMMAND_NV 0x0011 +#define GL_FRONT_FACE_COMMAND_NV 0x0012 +typedef void (APIENTRYP PFNGLCREATESTATESNVPROC) (GLsizei n, GLuint *states); +typedef void (APIENTRYP PFNGLDELETESTATESNVPROC) (GLsizei n, const GLuint *states); +typedef GLboolean (APIENTRYP PFNGLISSTATENVPROC) (GLuint state); +typedef void (APIENTRYP PFNGLSTATECAPTURENVPROC) (GLuint state, GLenum mode); +typedef GLuint (APIENTRYP PFNGLGETCOMMANDHEADERNVPROC) (GLenum tokenID, GLuint size); +typedef GLushort (APIENTRYP PFNGLGETSTAGEINDEXNVPROC) (GLenum shadertype); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSNVPROC) (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSADDRESSNVPROC) (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESNVPROC) (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLDRAWCOMMANDSSTATESADDRESSNVPROC) (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCREATECOMMANDLISTSNVPROC) (GLsizei n, GLuint *lists); +typedef void (APIENTRYP PFNGLDELETECOMMANDLISTSNVPROC) (GLsizei n, const GLuint *lists); +typedef GLboolean (APIENTRYP PFNGLISCOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLLISTDRAWCOMMANDSSTATESCLIENTNVPROC) (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +typedef void (APIENTRYP PFNGLCOMMANDLISTSEGMENTSNVPROC) (GLuint list, GLuint segments); +typedef void (APIENTRYP PFNGLCOMPILECOMMANDLISTNVPROC) (GLuint list); +typedef void (APIENTRYP PFNGLCALLCOMMANDLISTNVPROC) (GLuint list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCreateStatesNV (GLsizei n, GLuint *states); +GLAPI void APIENTRY glDeleteStatesNV (GLsizei n, const GLuint *states); +GLAPI GLboolean APIENTRY glIsStateNV (GLuint state); +GLAPI void APIENTRY glStateCaptureNV (GLuint state, GLenum mode); +GLAPI GLuint APIENTRY glGetCommandHeaderNV (GLenum tokenID, GLuint size); +GLAPI GLushort APIENTRY glGetStageIndexNV (GLenum shadertype); +GLAPI void APIENTRY glDrawCommandsNV (GLenum primitiveMode, GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsAddressNV (GLenum primitiveMode, const GLuint64 *indirects, const GLsizei *sizes, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesNV (GLuint buffer, const GLintptr *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glDrawCommandsStatesAddressNV (const GLuint64 *indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCreateCommandListsNV (GLsizei n, GLuint *lists); +GLAPI void APIENTRY glDeleteCommandListsNV (GLsizei n, const GLuint *lists); +GLAPI GLboolean APIENTRY glIsCommandListNV (GLuint list); +GLAPI void APIENTRY glListDrawCommandsStatesClientNV (GLuint list, GLuint segment, const void **indirects, const GLsizei *sizes, const GLuint *states, const GLuint *fbos, GLuint count); +GLAPI void APIENTRY glCommandListSegmentsNV (GLuint list, GLuint segments); +GLAPI void APIENTRY glCompileCommandListNV (GLuint list); +GLAPI void APIENTRY glCallCommandListNV (GLuint list); +#endif +#endif /* GL_NV_command_list */ + +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + +#ifndef GL_NV_conditional_render +#define GL_NV_conditional_render 1 +#define GL_QUERY_WAIT_NV 0x8E13 +#define GL_QUERY_NO_WAIT_NV 0x8E14 +#define GL_QUERY_BY_REGION_WAIT_NV 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT_NV 0x8E16 +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERNVPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginConditionalRenderNV (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRenderNV (void); +#endif +#endif /* GL_NV_conditional_render */ + +#ifndef GL_NV_conservative_raster +#define GL_NV_conservative_raster 1 +#define GL_CONSERVATIVE_RASTERIZATION_NV 0x9346 +#define GL_SUBPIXEL_PRECISION_BIAS_X_BITS_NV 0x9347 +#define GL_SUBPIXEL_PRECISION_BIAS_Y_BITS_NV 0x9348 +#define GL_MAX_SUBPIXEL_PRECISION_BIAS_BITS_NV 0x9349 +typedef void (APIENTRYP PFNGLSUBPIXELPRECISIONBIASNVPROC) (GLuint xbits, GLuint ybits); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybits); +#endif +#endif /* GL_NV_conservative_raster */ + +#ifndef GL_NV_conservative_raster_dilate +#define GL_NV_conservative_raster_dilate 1 +#define GL_CONSERVATIVE_RASTER_DILATE_NV 0x9379 +#define GL_CONSERVATIVE_RASTER_DILATE_RANGE_NV 0x937A +#define GL_CONSERVATIVE_RASTER_DILATE_GRANULARITY_NV 0x937B +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERFNVPROC) (GLenum pname, GLfloat value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat value); +#endif +#endif /* GL_NV_conservative_raster_dilate */ + +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + +#ifndef GL_NV_conservative_raster_pre_snap_triangles +#define GL_NV_conservative_raster_pre_snap_triangles 1 +#define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D +#define GL_CONSERVATIVE_RASTER_MODE_POST_SNAP_NV 0x954E +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_TRIANGLES_NV 0x954F +typedef void (APIENTRYP PFNGLCONSERVATIVERASTERPARAMETERINVPROC) (GLenum pname, GLint param); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param); +#endif +#endif /* GL_NV_conservative_raster_pre_snap_triangles */ + +#ifndef GL_NV_conservative_raster_underestimation +#define GL_NV_conservative_raster_underestimation 1 +#endif /* GL_NV_conservative_raster_underestimation */ + +#ifndef GL_NV_depth_buffer_float +#define GL_NV_depth_buffer_float 1 +#define GL_DEPTH_COMPONENT32F_NV 0x8DAB +#define GL_DEPTH32F_STENCIL8_NV 0x8DAC +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV_NV 0x8DAD +#define GL_DEPTH_BUFFER_FLOAT_MODE_NV 0x8DAF +typedef void (APIENTRYP PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLCLEARDEPTHDNVPROC) (GLdouble depth); +typedef void (APIENTRYP PFNGLDEPTHBOUNDSDNVPROC) (GLdouble zmin, GLdouble zmax); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthRangedNV (GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glClearDepthdNV (GLdouble depth); +GLAPI void APIENTRY glDepthBoundsdNV (GLdouble zmin, GLdouble zmax); +#endif +#endif /* GL_NV_depth_buffer_float */ + +#ifndef GL_NV_draw_vulkan_image +#define GL_NV_draw_vulkan_image 1 +typedef void (APIENTRY *GLVULKANPROCNV)(void); +typedef void (APIENTRYP PFNGLDRAWVKIMAGENVPROC) (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +typedef GLVULKANPROCNV (APIENTRYP PFNGLGETVKPROCADDRNVPROC) (const GLchar *name); +typedef void (APIENTRYP PFNGLWAITVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKSEMAPHORENVPROC) (GLuint64 vkSemaphore); +typedef void (APIENTRYP PFNGLSIGNALVKFENCENVPROC) (GLuint64 vkFence); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawVkImageNV (GLuint64 vkImage, GLuint sampler, GLfloat x0, GLfloat y0, GLfloat x1, GLfloat y1, GLfloat z, GLfloat s0, GLfloat t0, GLfloat s1, GLfloat t1); +GLAPI GLVULKANPROCNV APIENTRY glGetVkProcAddrNV (const GLchar *name); +GLAPI void APIENTRY glWaitVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkSemaphoreNV (GLuint64 vkSemaphore); +GLAPI void APIENTRY glSignalVkFenceNV (GLuint64 vkFence); +#endif +#endif /* GL_NV_draw_vulkan_image */ + +#ifndef GL_NV_fill_rectangle +#define GL_NV_fill_rectangle 1 +#define GL_FILL_RECTANGLE_NV 0x933C +#endif /* GL_NV_fill_rectangle */ + +#ifndef GL_NV_fragment_coverage_to_color +#define GL_NV_fragment_coverage_to_color 1 +#define GL_FRAGMENT_COVERAGE_TO_COLOR_NV 0x92DD +#define GL_FRAGMENT_COVERAGE_COLOR_NV 0x92DE +typedef void (APIENTRYP PFNGLFRAGMENTCOVERAGECOLORNVPROC) (GLuint color); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentCoverageColorNV (GLuint color); +#endif +#endif /* GL_NV_fragment_coverage_to_color */ + +#ifndef GL_NV_fragment_shader_barycentric +#define GL_NV_fragment_shader_barycentric 1 +#endif /* GL_NV_fragment_shader_barycentric */ + +#ifndef GL_NV_fragment_shader_interlock +#define GL_NV_fragment_shader_interlock 1 +#endif /* GL_NV_fragment_shader_interlock */ + +#ifndef GL_NV_framebuffer_mixed_samples +#define GL_NV_framebuffer_mixed_samples 1 +#define GL_COVERAGE_MODULATION_TABLE_NV 0x9331 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#define GL_DEPTH_SAMPLES_NV 0x932D +#define GL_STENCIL_SAMPLES_NV 0x932E +#define GL_MIXED_DEPTH_SAMPLES_SUPPORTED_NV 0x932F +#define GL_MIXED_STENCIL_SAMPLES_SUPPORTED_NV 0x9330 +#define GL_COVERAGE_MODULATION_NV 0x9332 +#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); +typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); +GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glCoverageModulationNV (GLenum components); +#endif +#endif /* GL_NV_framebuffer_mixed_samples */ + +#ifndef GL_NV_framebuffer_multisample_coverage +#define GL_NV_framebuffer_multisample_coverage 1 +#define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB +#define GL_RENDERBUFFER_COLOR_SAMPLES_NV 0x8E10 +#define GL_MAX_MULTISAMPLE_COVERAGE_MODES_NV 0x8E11 +#define GL_MULTISAMPLE_COVERAGE_MODES_NV 0x8E12 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_NV_framebuffer_multisample_coverage */ + +#ifndef GL_NV_geometry_shader_passthrough +#define GL_NV_geometry_shader_passthrough 1 +#endif /* GL_NV_geometry_shader_passthrough */ + +#ifndef GL_NV_gpu_shader5 +#define GL_NV_gpu_shader5 1 +typedef khronos_int64_t GLint64EXT; +#define GL_INT64_NV 0x140E +#define GL_UNSIGNED_INT64_NV 0x140F +#define GL_INT8_NV 0x8FE0 +#define GL_INT8_VEC2_NV 0x8FE1 +#define GL_INT8_VEC3_NV 0x8FE2 +#define GL_INT8_VEC4_NV 0x8FE3 +#define GL_INT16_NV 0x8FE4 +#define GL_INT16_VEC2_NV 0x8FE5 +#define GL_INT16_VEC3_NV 0x8FE6 +#define GL_INT16_VEC4_NV 0x8FE7 +#define GL_INT64_VEC2_NV 0x8FE9 +#define GL_INT64_VEC3_NV 0x8FEA +#define GL_INT64_VEC4_NV 0x8FEB +#define GL_UNSIGNED_INT8_NV 0x8FEC +#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED +#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE +#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF +#define GL_UNSIGNED_INT16_NV 0x8FF0 +#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 +#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 +#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 +#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); +GLAPI void APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); +GLAPI void APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); +GLAPI void APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); +GLAPI void APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); +GLAPI void APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_NV_gpu_shader5 */ + +#ifndef GL_NV_internalformat_sample_query +#define GL_NV_internalformat_sample_query 1 +#define GL_MULTISAMPLES_NV 0x9371 +#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 +#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 +#define GL_CONFORMANT_NV 0x9374 +typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params); +#endif +#endif /* GL_NV_internalformat_sample_query */ + +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + +#ifndef GL_NV_memory_object_sparse +#define GL_NV_memory_object_sparse 1 +typedef void (APIENTRYP PFNGLBUFFERPAGECOMMITMENTMEMNVPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (APIENTRYP PFNGLTEXPAGECOMMITMENTMEMNVPROC) (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +typedef void (APIENTRYP PFNGLNAMEDBUFFERPAGECOMMITMENTMEMNVPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +typedef void (APIENTRYP PFNGLTEXTUREPAGECOMMITMENTMEMNVPROC) (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferPageCommitmentMemNV (GLenum target, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GLAPI void APIENTRY glTexPageCommitmentMemNV (GLenum target, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +GLAPI void APIENTRY glNamedBufferPageCommitmentMemNV (GLuint buffer, GLintptr offset, GLsizeiptr size, GLuint memory, GLuint64 memOffset, GLboolean commit); +GLAPI void APIENTRY glTexturePageCommitmentMemNV (GLuint texture, GLint layer, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset, GLboolean commit); +#endif +#endif /* GL_NV_memory_object_sparse */ + +#ifndef GL_NV_mesh_shader +#define GL_NV_mesh_shader 1 +#define GL_MESH_SHADER_NV 0x9559 +#define GL_TASK_SHADER_NV 0x955A +#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60 +#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61 +#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62 +#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63 +#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64 +#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65 +#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66 +#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67 +#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68 +#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69 +#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A +#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B +#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C +#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D +#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E +#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F +#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2 +#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3 +#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536 +#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537 +#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538 +#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539 +#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A +#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D +#define GL_MAX_MESH_VIEWS_NV 0x9557 +#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF +#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543 +#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B +#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C +#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E +#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F +#define GL_MESH_VERTICES_OUT_NV 0x9579 +#define GL_MESH_PRIMITIVES_OUT_NV 0x957A +#define GL_MESH_OUTPUT_TYPE_NV 0x957B +#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D +#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0 +#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1 +#define GL_MESH_SHADER_BIT_NV 0x00000040 +#define GL_TASK_SHADER_BIT_NV 0x00000080 +#define GL_MESH_SUBROUTINE_NV 0x957C +#define GL_TASK_SUBROUTINE_NV 0x957D +#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E +#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F +typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count); +typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count); +GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_NV_mesh_shader */ + +#ifndef GL_NV_path_rendering +#define GL_NV_path_rendering 1 +#define GL_PATH_FORMAT_SVG_NV 0x9070 +#define GL_PATH_FORMAT_PS_NV 0x9071 +#define GL_STANDARD_FONT_NAME_NV 0x9072 +#define GL_SYSTEM_FONT_NAME_NV 0x9073 +#define GL_FILE_NAME_NV 0x9074 +#define GL_PATH_STROKE_WIDTH_NV 0x9075 +#define GL_PATH_END_CAPS_NV 0x9076 +#define GL_PATH_INITIAL_END_CAP_NV 0x9077 +#define GL_PATH_TERMINAL_END_CAP_NV 0x9078 +#define GL_PATH_JOIN_STYLE_NV 0x9079 +#define GL_PATH_MITER_LIMIT_NV 0x907A +#define GL_PATH_DASH_CAPS_NV 0x907B +#define GL_PATH_INITIAL_DASH_CAP_NV 0x907C +#define GL_PATH_TERMINAL_DASH_CAP_NV 0x907D +#define GL_PATH_DASH_OFFSET_NV 0x907E +#define GL_PATH_CLIENT_LENGTH_NV 0x907F +#define GL_PATH_FILL_MODE_NV 0x9080 +#define GL_PATH_FILL_MASK_NV 0x9081 +#define GL_PATH_FILL_COVER_MODE_NV 0x9082 +#define GL_PATH_STROKE_COVER_MODE_NV 0x9083 +#define GL_PATH_STROKE_MASK_NV 0x9084 +#define GL_COUNT_UP_NV 0x9088 +#define GL_COUNT_DOWN_NV 0x9089 +#define GL_PATH_OBJECT_BOUNDING_BOX_NV 0x908A +#define GL_CONVEX_HULL_NV 0x908B +#define GL_BOUNDING_BOX_NV 0x908D +#define GL_TRANSLATE_X_NV 0x908E +#define GL_TRANSLATE_Y_NV 0x908F +#define GL_TRANSLATE_2D_NV 0x9090 +#define GL_TRANSLATE_3D_NV 0x9091 +#define GL_AFFINE_2D_NV 0x9092 +#define GL_AFFINE_3D_NV 0x9094 +#define GL_TRANSPOSE_AFFINE_2D_NV 0x9096 +#define GL_TRANSPOSE_AFFINE_3D_NV 0x9098 +#define GL_UTF8_NV 0x909A +#define GL_UTF16_NV 0x909B +#define GL_BOUNDING_BOX_OF_BOUNDING_BOXES_NV 0x909C +#define GL_PATH_COMMAND_COUNT_NV 0x909D +#define GL_PATH_COORD_COUNT_NV 0x909E +#define GL_PATH_DASH_ARRAY_COUNT_NV 0x909F +#define GL_PATH_COMPUTED_LENGTH_NV 0x90A0 +#define GL_PATH_FILL_BOUNDING_BOX_NV 0x90A1 +#define GL_PATH_STROKE_BOUNDING_BOX_NV 0x90A2 +#define GL_SQUARE_NV 0x90A3 +#define GL_ROUND_NV 0x90A4 +#define GL_TRIANGULAR_NV 0x90A5 +#define GL_BEVEL_NV 0x90A6 +#define GL_MITER_REVERT_NV 0x90A7 +#define GL_MITER_TRUNCATE_NV 0x90A8 +#define GL_SKIP_MISSING_GLYPH_NV 0x90A9 +#define GL_USE_MISSING_GLYPH_NV 0x90AA +#define GL_PATH_ERROR_POSITION_NV 0x90AB +#define GL_ACCUM_ADJACENT_PAIRS_NV 0x90AD +#define GL_ADJACENT_PAIRS_NV 0x90AE +#define GL_FIRST_TO_REST_NV 0x90AF +#define GL_PATH_GEN_MODE_NV 0x90B0 +#define GL_PATH_GEN_COEFF_NV 0x90B1 +#define GL_PATH_GEN_COMPONENTS_NV 0x90B3 +#define GL_PATH_STENCIL_FUNC_NV 0x90B7 +#define GL_PATH_STENCIL_REF_NV 0x90B8 +#define GL_PATH_STENCIL_VALUE_MASK_NV 0x90B9 +#define GL_PATH_STENCIL_DEPTH_OFFSET_FACTOR_NV 0x90BD +#define GL_PATH_STENCIL_DEPTH_OFFSET_UNITS_NV 0x90BE +#define GL_PATH_COVER_DEPTH_FUNC_NV 0x90BF +#define GL_PATH_DASH_OFFSET_RESET_NV 0x90B4 +#define GL_MOVE_TO_RESETS_NV 0x90B5 +#define GL_MOVE_TO_CONTINUES_NV 0x90B6 +#define GL_CLOSE_PATH_NV 0x00 +#define GL_MOVE_TO_NV 0x02 +#define GL_RELATIVE_MOVE_TO_NV 0x03 +#define GL_LINE_TO_NV 0x04 +#define GL_RELATIVE_LINE_TO_NV 0x05 +#define GL_HORIZONTAL_LINE_TO_NV 0x06 +#define GL_RELATIVE_HORIZONTAL_LINE_TO_NV 0x07 +#define GL_VERTICAL_LINE_TO_NV 0x08 +#define GL_RELATIVE_VERTICAL_LINE_TO_NV 0x09 +#define GL_QUADRATIC_CURVE_TO_NV 0x0A +#define GL_RELATIVE_QUADRATIC_CURVE_TO_NV 0x0B +#define GL_CUBIC_CURVE_TO_NV 0x0C +#define GL_RELATIVE_CUBIC_CURVE_TO_NV 0x0D +#define GL_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0E +#define GL_RELATIVE_SMOOTH_QUADRATIC_CURVE_TO_NV 0x0F +#define GL_SMOOTH_CUBIC_CURVE_TO_NV 0x10 +#define GL_RELATIVE_SMOOTH_CUBIC_CURVE_TO_NV 0x11 +#define GL_SMALL_CCW_ARC_TO_NV 0x12 +#define GL_RELATIVE_SMALL_CCW_ARC_TO_NV 0x13 +#define GL_SMALL_CW_ARC_TO_NV 0x14 +#define GL_RELATIVE_SMALL_CW_ARC_TO_NV 0x15 +#define GL_LARGE_CCW_ARC_TO_NV 0x16 +#define GL_RELATIVE_LARGE_CCW_ARC_TO_NV 0x17 +#define GL_LARGE_CW_ARC_TO_NV 0x18 +#define GL_RELATIVE_LARGE_CW_ARC_TO_NV 0x19 +#define GL_RESTART_PATH_NV 0xF0 +#define GL_DUP_FIRST_CUBIC_CURVE_TO_NV 0xF2 +#define GL_DUP_LAST_CUBIC_CURVE_TO_NV 0xF4 +#define GL_RECT_NV 0xF6 +#define GL_CIRCULAR_CCW_ARC_TO_NV 0xF8 +#define GL_CIRCULAR_CW_ARC_TO_NV 0xFA +#define GL_CIRCULAR_TANGENT_ARC_TO_NV 0xFC +#define GL_ARC_TO_NV 0xFE +#define GL_RELATIVE_ARC_TO_NV 0xFF +#define GL_BOLD_BIT_NV 0x01 +#define GL_ITALIC_BIT_NV 0x02 +#define GL_GLYPH_WIDTH_BIT_NV 0x01 +#define GL_GLYPH_HEIGHT_BIT_NV 0x02 +#define GL_GLYPH_HORIZONTAL_BEARING_X_BIT_NV 0x04 +#define GL_GLYPH_HORIZONTAL_BEARING_Y_BIT_NV 0x08 +#define GL_GLYPH_HORIZONTAL_BEARING_ADVANCE_BIT_NV 0x10 +#define GL_GLYPH_VERTICAL_BEARING_X_BIT_NV 0x20 +#define GL_GLYPH_VERTICAL_BEARING_Y_BIT_NV 0x40 +#define GL_GLYPH_VERTICAL_BEARING_ADVANCE_BIT_NV 0x80 +#define GL_GLYPH_HAS_KERNING_BIT_NV 0x100 +#define GL_FONT_X_MIN_BOUNDS_BIT_NV 0x00010000 +#define GL_FONT_Y_MIN_BOUNDS_BIT_NV 0x00020000 +#define GL_FONT_X_MAX_BOUNDS_BIT_NV 0x00040000 +#define GL_FONT_Y_MAX_BOUNDS_BIT_NV 0x00080000 +#define GL_FONT_UNITS_PER_EM_BIT_NV 0x00100000 +#define GL_FONT_ASCENDER_BIT_NV 0x00200000 +#define GL_FONT_DESCENDER_BIT_NV 0x00400000 +#define GL_FONT_HEIGHT_BIT_NV 0x00800000 +#define GL_FONT_MAX_ADVANCE_WIDTH_BIT_NV 0x01000000 +#define GL_FONT_MAX_ADVANCE_HEIGHT_BIT_NV 0x02000000 +#define GL_FONT_UNDERLINE_POSITION_BIT_NV 0x04000000 +#define GL_FONT_UNDERLINE_THICKNESS_BIT_NV 0x08000000 +#define GL_FONT_HAS_KERNING_BIT_NV 0x10000000 +#define GL_ROUNDED_RECT_NV 0xE8 +#define GL_RELATIVE_ROUNDED_RECT_NV 0xE9 +#define GL_ROUNDED_RECT2_NV 0xEA +#define GL_RELATIVE_ROUNDED_RECT2_NV 0xEB +#define GL_ROUNDED_RECT4_NV 0xEC +#define GL_RELATIVE_ROUNDED_RECT4_NV 0xED +#define GL_ROUNDED_RECT8_NV 0xEE +#define GL_RELATIVE_ROUNDED_RECT8_NV 0xEF +#define GL_RELATIVE_RECT_NV 0xF7 +#define GL_FONT_GLYPHS_AVAILABLE_NV 0x9368 +#define GL_FONT_TARGET_UNAVAILABLE_NV 0x9369 +#define GL_FONT_UNAVAILABLE_NV 0x936A +#define GL_FONT_UNINTELLIGIBLE_NV 0x936B +#define GL_CONIC_CURVE_TO_NV 0x1A +#define GL_RELATIVE_CONIC_CURVE_TO_NV 0x1B +#define GL_FONT_NUM_GLYPH_INDICES_BIT_NV 0x20000000 +#define GL_STANDARD_FONT_FORMAT_NV 0x936C +#define GL_PATH_PROJECTION_NV 0x1701 +#define GL_PATH_MODELVIEW_NV 0x1700 +#define GL_PATH_MODELVIEW_STACK_DEPTH_NV 0x0BA3 +#define GL_PATH_MODELVIEW_MATRIX_NV 0x0BA6 +#define GL_PATH_MAX_MODELVIEW_STACK_DEPTH_NV 0x0D36 +#define GL_PATH_TRANSPOSE_MODELVIEW_MATRIX_NV 0x84E3 +#define GL_PATH_PROJECTION_STACK_DEPTH_NV 0x0BA4 +#define GL_PATH_PROJECTION_MATRIX_NV 0x0BA7 +#define GL_PATH_MAX_PROJECTION_STACK_DEPTH_NV 0x0D38 +#define GL_PATH_TRANSPOSE_PROJECTION_MATRIX_NV 0x84E4 +#define GL_FRAGMENT_INPUT_NV 0x936D +typedef GLuint (APIENTRYP PFNGLGENPATHSNVPROC) (GLsizei range); +typedef void (APIENTRYP PFNGLDELETEPATHSNVPROC) (GLuint path, GLsizei range); +typedef GLboolean (APIENTRYP PFNGLISPATHNVPROC) (GLuint path); +typedef void (APIENTRYP PFNGLPATHCOMMANDSNVPROC) (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHCOORDSNVPROC) (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOMMANDSNVPROC) (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSUBCOORDSNVPROC) (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +typedef void (APIENTRYP PFNGLPATHSTRINGNVPROC) (GLuint path, GLenum format, GLsizei length, const void *pathString); +typedef void (APIENTRYP PFNGLPATHGLYPHSNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPATHGLYPHRANGENVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLWEIGHTPATHSNVPROC) (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +typedef void (APIENTRYP PFNGLCOPYPATHNVPROC) (GLuint resultPath, GLuint srcPath); +typedef void (APIENTRYP PFNGLINTERPOLATEPATHSNVPROC) (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +typedef void (APIENTRYP PFNGLTRANSFORMPATHNVPROC) (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, const GLint *value); +typedef void (APIENTRYP PFNGLPATHPARAMETERINVPROC) (GLuint path, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, const GLfloat *value); +typedef void (APIENTRYP PFNGLPATHPARAMETERFNVPROC) (GLuint path, GLenum pname, GLfloat value); +typedef void (APIENTRYP PFNGLPATHDASHARRAYNVPROC) (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +typedef void (APIENTRYP PFNGLPATHSTENCILFUNCNVPROC) (GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLPATHSTENCILDEPTHOFFSETNVPROC) (GLfloat factor, GLfloat units); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLPATHCOVERDEPTHFUNCNVPROC) (GLenum func); +typedef void (APIENTRYP PFNGLCOVERFILLPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHNVPROC) (GLuint path, GLenum coverMode); +typedef void (APIENTRYP PFNGLCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLGETPATHPARAMETERIVNVPROC) (GLuint path, GLenum pname, GLint *value); +typedef void (APIENTRYP PFNGLGETPATHPARAMETERFVNVPROC) (GLuint path, GLenum pname, GLfloat *value); +typedef void (APIENTRYP PFNGLGETPATHCOMMANDSNVPROC) (GLuint path, GLubyte *commands); +typedef void (APIENTRYP PFNGLGETPATHCOORDSNVPROC) (GLuint path, GLfloat *coords); +typedef void (APIENTRYP PFNGLGETPATHDASHARRAYNVPROC) (GLuint path, GLfloat *dashArray); +typedef void (APIENTRYP PFNGLGETPATHMETRICSNVPROC) (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHMETRICRANGENVPROC) (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +typedef void (APIENTRYP PFNGLGETPATHSPACINGNVPROC) (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +typedef GLboolean (APIENTRYP PFNGLISPOINTINFILLPATHNVPROC) (GLuint path, GLuint mask, GLfloat x, GLfloat y); +typedef GLboolean (APIENTRYP PFNGLISPOINTINSTROKEPATHNVPROC) (GLuint path, GLfloat x, GLfloat y); +typedef GLfloat (APIENTRYP PFNGLGETPATHLENGTHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments); +typedef GLboolean (APIENTRYP PFNGLPOINTALONGPATHNVPROC) (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOAD3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X2FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULT3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSE3X3FNVPROC) (GLenum matrixMode, const GLfloat *m); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHNVPROC) (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHNVPROC) (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERFILLPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef void (APIENTRYP PFNGLSTENCILTHENCOVERSTROKEPATHINSTANCEDNVPROC) (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glGenPathsNV (GLsizei range); +GLAPI void APIENTRY glDeletePathsNV (GLuint path, GLsizei range); +GLAPI GLboolean APIENTRY glIsPathNV (GLuint path); +GLAPI void APIENTRY glPathCommandsNV (GLuint path, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathCoordsNV (GLuint path, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCommandsNV (GLuint path, GLsizei commandStart, GLsizei commandsToDelete, GLsizei numCommands, const GLubyte *commands, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathSubCoordsNV (GLuint path, GLsizei coordStart, GLsizei numCoords, GLenum coordType, const void *coords); +GLAPI void APIENTRY glPathStringNV (GLuint path, GLenum format, GLsizei length, const void *pathString); +GLAPI void APIENTRY glPathGlyphsNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLsizei numGlyphs, GLenum type, const void *charcodes, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glPathGlyphRangeNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyph, GLsizei numGlyphs, GLenum handleMissingGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glWeightPathsNV (GLuint resultPath, GLsizei numPaths, const GLuint *paths, const GLfloat *weights); +GLAPI void APIENTRY glCopyPathNV (GLuint resultPath, GLuint srcPath); +GLAPI void APIENTRY glInterpolatePathsNV (GLuint resultPath, GLuint pathA, GLuint pathB, GLfloat weight); +GLAPI void APIENTRY glTransformPathNV (GLuint resultPath, GLuint srcPath, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glPathParameterivNV (GLuint path, GLenum pname, const GLint *value); +GLAPI void APIENTRY glPathParameteriNV (GLuint path, GLenum pname, GLint value); +GLAPI void APIENTRY glPathParameterfvNV (GLuint path, GLenum pname, const GLfloat *value); +GLAPI void APIENTRY glPathParameterfNV (GLuint path, GLenum pname, GLfloat value); +GLAPI void APIENTRY glPathDashArrayNV (GLuint path, GLsizei dashCount, const GLfloat *dashArray); +GLAPI void APIENTRY glPathStencilFuncNV (GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glPathStencilDepthOffsetNV (GLfloat factor, GLfloat units); +GLAPI void APIENTRY glStencilFillPathNV (GLuint path, GLenum fillMode, GLuint mask); +GLAPI void APIENTRY glStencilStrokePathNV (GLuint path, GLint reference, GLuint mask); +GLAPI void APIENTRY glStencilFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glPathCoverDepthFuncNV (GLenum func); +GLAPI void APIENTRY glCoverFillPathNV (GLuint path, GLenum coverMode); +GLAPI void APIENTRY glCoverStrokePathNV (GLuint path, GLenum coverMode); +GLAPI void APIENTRY glCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glGetPathParameterivNV (GLuint path, GLenum pname, GLint *value); +GLAPI void APIENTRY glGetPathParameterfvNV (GLuint path, GLenum pname, GLfloat *value); +GLAPI void APIENTRY glGetPathCommandsNV (GLuint path, GLubyte *commands); +GLAPI void APIENTRY glGetPathCoordsNV (GLuint path, GLfloat *coords); +GLAPI void APIENTRY glGetPathDashArrayNV (GLuint path, GLfloat *dashArray); +GLAPI void APIENTRY glGetPathMetricsNV (GLbitfield metricQueryMask, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathMetricRangeNV (GLbitfield metricQueryMask, GLuint firstPathName, GLsizei numPaths, GLsizei stride, GLfloat *metrics); +GLAPI void APIENTRY glGetPathSpacingNV (GLenum pathListMode, GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLfloat advanceScale, GLfloat kerningScale, GLenum transformType, GLfloat *returnedSpacing); +GLAPI GLboolean APIENTRY glIsPointInFillPathNV (GLuint path, GLuint mask, GLfloat x, GLfloat y); +GLAPI GLboolean APIENTRY glIsPointInStrokePathNV (GLuint path, GLfloat x, GLfloat y); +GLAPI GLfloat APIENTRY glGetPathLengthNV (GLuint path, GLsizei startSegment, GLsizei numSegments); +GLAPI GLboolean APIENTRY glPointAlongPathNV (GLuint path, GLsizei startSegment, GLsizei numSegments, GLfloat distance, GLfloat *x, GLfloat *y, GLfloat *tangentX, GLfloat *tangentY); +GLAPI void APIENTRY glMatrixLoad3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoad3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x2fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMult3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTranspose3x3fNV (GLenum matrixMode, const GLfloat *m); +GLAPI void APIENTRY glStencilThenCoverFillPathNV (GLuint path, GLenum fillMode, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverStrokePathNV (GLuint path, GLint reference, GLuint mask, GLenum coverMode); +GLAPI void APIENTRY glStencilThenCoverFillPathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLenum fillMode, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI void APIENTRY glStencilThenCoverStrokePathInstancedNV (GLsizei numPaths, GLenum pathNameType, const void *paths, GLuint pathBase, GLint reference, GLuint mask, GLenum coverMode, GLenum transformType, const GLfloat *transformValues); +GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint pathParameterTemplate, GLfloat emScale, GLuint *baseAndCount); +GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); +GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); +GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params); +#endif +#endif /* GL_NV_path_rendering */ + +#ifndef GL_NV_path_rendering_shared_edge +#define GL_NV_path_rendering_shared_edge 1 +#define GL_SHARED_EDGE_NV 0xC0 +#endif /* GL_NV_path_rendering_shared_edge */ + +#ifndef GL_NV_primitive_shading_rate +#define GL_NV_primitive_shading_rate 1 +#define GL_SHADING_RATE_IMAGE_PER_PRIMITIVE_NV 0x95B1 +#define GL_SHADING_RATE_IMAGE_PALETTE_COUNT_NV 0x95B2 +#endif /* GL_NV_primitive_shading_rate */ + +#ifndef GL_NV_representative_fragment_test +#define GL_NV_representative_fragment_test 1 +#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F +#endif /* GL_NV_representative_fragment_test */ + +#ifndef GL_NV_sample_locations +#define GL_NV_sample_locations 1 +#define GL_SAMPLE_LOCATION_SUBPIXEL_BITS_NV 0x933D +#define GL_SAMPLE_LOCATION_PIXEL_GRID_WIDTH_NV 0x933E +#define GL_SAMPLE_LOCATION_PIXEL_GRID_HEIGHT_NV 0x933F +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_TABLE_SIZE_NV 0x9340 +#define GL_SAMPLE_LOCATION_NV 0x8E50 +#define GL_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9341 +#define GL_FRAMEBUFFER_PROGRAMMABLE_SAMPLE_LOCATIONS_NV 0x9342 +#define GL_FRAMEBUFFER_SAMPLE_LOCATION_PIXEL_GRID_NV 0x9343 +typedef void (APIENTRYP PFNGLFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERSAMPLELOCATIONSFVNVPROC) (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLRESOLVEDEPTHVALUESNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferSampleLocationsfvNV (GLenum target, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glNamedFramebufferSampleLocationsfvNV (GLuint framebuffer, GLuint start, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glResolveDepthValuesNV (void); +#endif +#endif /* GL_NV_sample_locations */ + +#ifndef GL_NV_sample_mask_override_coverage +#define GL_NV_sample_mask_override_coverage 1 +#endif /* GL_NV_sample_mask_override_coverage */ + +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + +#ifndef GL_NV_shader_atomic_counters +#define GL_NV_shader_atomic_counters 1 +#endif /* GL_NV_shader_atomic_counters */ + +#ifndef GL_NV_shader_atomic_float +#define GL_NV_shader_atomic_float 1 +#endif /* GL_NV_shader_atomic_float */ + +#ifndef GL_NV_shader_atomic_float64 +#define GL_NV_shader_atomic_float64 1 +#endif /* GL_NV_shader_atomic_float64 */ + +#ifndef GL_NV_shader_atomic_fp16_vector +#define GL_NV_shader_atomic_fp16_vector 1 +#endif /* GL_NV_shader_atomic_fp16_vector */ + +#ifndef GL_NV_shader_atomic_int64 +#define GL_NV_shader_atomic_int64 1 +#endif /* GL_NV_shader_atomic_int64 */ + +#ifndef GL_NV_shader_buffer_load +#define GL_NV_shader_buffer_load 1 +#define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D +#define GL_GPU_ADDRESS_NV 0x8F34 +#define GL_MAX_SHADER_BUFFER_ADDRESS_NV 0x8F35 +typedef void (APIENTRYP PFNGLMAKEBUFFERRESIDENTNVPROC) (GLenum target, GLenum access); +typedef void (APIENTRYP PFNGLMAKEBUFFERNONRESIDENTNVPROC) (GLenum target); +typedef GLboolean (APIENTRYP PFNGLISBUFFERRESIDENTNVPROC) (GLenum target); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERRESIDENTNVPROC) (GLuint buffer, GLenum access); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC) (GLuint buffer); +typedef GLboolean (APIENTRYP PFNGLISNAMEDBUFFERRESIDENTNVPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERUI64VNVPROC) (GLenum target, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC) (GLuint buffer, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETINTEGERUI64VNVPROC) (GLenum value, GLuint64EXT *result); +typedef void (APIENTRYP PFNGLUNIFORMUI64NVPROC) (GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64NVPROC) (GLuint program, GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMakeBufferResidentNV (GLenum target, GLenum access); +GLAPI void APIENTRY glMakeBufferNonResidentNV (GLenum target); +GLAPI GLboolean APIENTRY glIsBufferResidentNV (GLenum target); +GLAPI void APIENTRY glMakeNamedBufferResidentNV (GLuint buffer, GLenum access); +GLAPI void APIENTRY glMakeNamedBufferNonResidentNV (GLuint buffer); +GLAPI GLboolean APIENTRY glIsNamedBufferResidentNV (GLuint buffer); +GLAPI void APIENTRY glGetBufferParameterui64vNV (GLenum target, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetNamedBufferParameterui64vNV (GLuint buffer, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetIntegerui64vNV (GLenum value, GLuint64EXT *result); +GLAPI void APIENTRY glUniformui64NV (GLint location, GLuint64EXT value); +GLAPI void APIENTRY glUniformui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformui64vNV (GLuint program, GLint location, GLuint64EXT *params); +GLAPI void APIENTRY glProgramUniformui64NV (GLuint program, GLint location, GLuint64EXT value); +GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif +#endif /* GL_NV_shader_buffer_load */ + +#ifndef GL_NV_shader_buffer_store +#define GL_NV_shader_buffer_store 1 +#define GL_SHADER_GLOBAL_ACCESS_BARRIER_BIT_NV 0x00000010 +#endif /* GL_NV_shader_buffer_store */ + +#ifndef GL_NV_shader_subgroup_partitioned +#define GL_NV_shader_subgroup_partitioned 1 +#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100 +#endif /* GL_NV_shader_subgroup_partitioned */ + +#ifndef GL_NV_shader_texture_footprint +#define GL_NV_shader_texture_footprint 1 +#endif /* GL_NV_shader_texture_footprint */ + +#ifndef GL_NV_shader_thread_group +#define GL_NV_shader_thread_group 1 +#define GL_WARP_SIZE_NV 0x9339 +#define GL_WARPS_PER_SM_NV 0x933A +#define GL_SM_COUNT_NV 0x933B +#endif /* GL_NV_shader_thread_group */ + +#ifndef GL_NV_shader_thread_shuffle +#define GL_NV_shader_thread_shuffle 1 +#endif /* GL_NV_shader_thread_shuffle */ + +#ifndef GL_NV_shading_rate_image +#define GL_NV_shading_rate_image 1 +#define GL_SHADING_RATE_IMAGE_NV 0x9563 +#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564 +#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565 +#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569 +#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A +#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B +#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C +#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D +#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E +#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F +#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B +#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C +#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D +#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E +#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F +#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE +#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF +#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0 +typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate); +typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture); +GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate); +GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location); +GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize); +GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order); +GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations); +#endif +#endif /* GL_NV_shading_rate_image */ + +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ + +#ifndef GL_NV_texture_barrier +#define GL_NV_texture_barrier 1 +typedef void (APIENTRYP PFNGLTEXTUREBARRIERNVPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureBarrierNV (void); +#endif +#endif /* GL_NV_texture_barrier */ + +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 +#endif /* GL_NV_texture_rectangle_compressed */ + +#ifndef GL_NV_uniform_buffer_std430_layout +#define GL_NV_uniform_buffer_std430_layout 1 +#endif /* GL_NV_uniform_buffer_std430_layout */ + +#ifndef GL_NV_uniform_buffer_unified_memory +#define GL_NV_uniform_buffer_unified_memory 1 +#define GL_UNIFORM_BUFFER_UNIFIED_NV 0x936E +#define GL_UNIFORM_BUFFER_ADDRESS_NV 0x936F +#define GL_UNIFORM_BUFFER_LENGTH_NV 0x9370 +#endif /* GL_NV_uniform_buffer_unified_memory */ + +#ifndef GL_NV_vertex_attrib_integer_64bit +#define GL_NV_vertex_attrib_integer_64bit 1 +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64NVPROC) (GLuint index, GLint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64NVPROC) (GLuint index, GLuint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLI64VNVPROC) (GLuint index, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLUI64VNVPROC) (GLuint index, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1i64NV (GLuint index, GLint64EXT x); +GLAPI void APIENTRY glVertexAttribL2i64NV (GLuint index, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glVertexAttribL3i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glVertexAttribL4i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glVertexAttribL1i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL1ui64NV (GLuint index, GLuint64EXT x); +GLAPI void APIENTRY glVertexAttribL2ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glVertexAttribL3ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glVertexAttribL4ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glVertexAttribL1ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glGetVertexAttribLi64vNV (GLuint index, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetVertexAttribLui64vNV (GLuint index, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glVertexAttribLFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +#endif +#endif /* GL_NV_vertex_attrib_integer_64bit */ + +#ifndef GL_NV_vertex_buffer_unified_memory +#define GL_NV_vertex_buffer_unified_memory 1 +#define GL_VERTEX_ATTRIB_ARRAY_UNIFIED_NV 0x8F1E +#define GL_ELEMENT_ARRAY_UNIFIED_NV 0x8F1F +#define GL_VERTEX_ATTRIB_ARRAY_ADDRESS_NV 0x8F20 +#define GL_VERTEX_ARRAY_ADDRESS_NV 0x8F21 +#define GL_NORMAL_ARRAY_ADDRESS_NV 0x8F22 +#define GL_COLOR_ARRAY_ADDRESS_NV 0x8F23 +#define GL_INDEX_ARRAY_ADDRESS_NV 0x8F24 +#define GL_TEXTURE_COORD_ARRAY_ADDRESS_NV 0x8F25 +#define GL_EDGE_FLAG_ARRAY_ADDRESS_NV 0x8F26 +#define GL_SECONDARY_COLOR_ARRAY_ADDRESS_NV 0x8F27 +#define GL_FOG_COORD_ARRAY_ADDRESS_NV 0x8F28 +#define GL_ELEMENT_ARRAY_ADDRESS_NV 0x8F29 +#define GL_VERTEX_ATTRIB_ARRAY_LENGTH_NV 0x8F2A +#define GL_VERTEX_ARRAY_LENGTH_NV 0x8F2B +#define GL_NORMAL_ARRAY_LENGTH_NV 0x8F2C +#define GL_COLOR_ARRAY_LENGTH_NV 0x8F2D +#define GL_INDEX_ARRAY_LENGTH_NV 0x8F2E +#define GL_TEXTURE_COORD_ARRAY_LENGTH_NV 0x8F2F +#define GL_EDGE_FLAG_ARRAY_LENGTH_NV 0x8F30 +#define GL_SECONDARY_COLOR_ARRAY_LENGTH_NV 0x8F31 +#define GL_FOG_COORD_ARRAY_LENGTH_NV 0x8F32 +#define GL_ELEMENT_ARRAY_LENGTH_NV 0x8F33 +#define GL_DRAW_INDIRECT_UNIFIED_NV 0x8F40 +#define GL_DRAW_INDIRECT_ADDRESS_NV 0x8F41 +#define GL_DRAW_INDIRECT_LENGTH_NV 0x8F42 +typedef void (APIENTRYP PFNGLBUFFERADDRESSRANGENVPROC) (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +typedef void (APIENTRYP PFNGLVERTEXFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLNORMALFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLINDEXFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLTEXCOORDFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLEDGEFLAGFORMATNVPROC) (GLsizei stride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLFOGCOORDFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLGETINTEGERUI64I_VNVPROC) (GLenum value, GLuint index, GLuint64EXT *result); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferAddressRangeNV (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +GLAPI void APIENTRY glVertexFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glNormalFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glIndexFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glTexCoordFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glEdgeFlagFormatNV (GLsizei stride); +GLAPI void APIENTRY glSecondaryColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glFogCoordFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glVertexAttribFormatNV (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +GLAPI void APIENTRY glVertexAttribIFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glGetIntegerui64i_vNV (GLenum value, GLuint index, GLuint64EXT *result); +#endif +#endif /* GL_NV_vertex_buffer_unified_memory */ + +#ifndef GL_NV_viewport_array2 +#define GL_NV_viewport_array2 1 +#endif /* GL_NV_viewport_array2 */ + +#ifndef GL_NV_viewport_swizzle +#define GL_NV_viewport_swizzle 1 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_X_NV 0x9350 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_X_NV 0x9351 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Y_NV 0x9352 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Y_NV 0x9353 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_Z_NV 0x9354 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_Z_NV 0x9355 +#define GL_VIEWPORT_SWIZZLE_POSITIVE_W_NV 0x9356 +#define GL_VIEWPORT_SWIZZLE_NEGATIVE_W_NV 0x9357 +#define GL_VIEWPORT_SWIZZLE_X_NV 0x9358 +#define GL_VIEWPORT_SWIZZLE_Y_NV 0x9359 +#define GL_VIEWPORT_SWIZZLE_Z_NV 0x935A +#define GL_VIEWPORT_SWIZZLE_W_NV 0x935B +typedef void (APIENTRYP PFNGLVIEWPORTSWIZZLENVPROC) (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportSwizzleNV (GLuint index, GLenum swizzlex, GLenum swizzley, GLenum swizzlez, GLenum swizzlew); +#endif +#endif /* GL_NV_viewport_swizzle */ + +#ifndef GL_OVR_multiview +#define GL_OVR_multiview 1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_NUM_VIEWS_OVR 0x9630 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_BASE_VIEW_INDEX_OVR 0x9632 +#define GL_MAX_VIEWS_OVR 0x9631 +#define GL_FRAMEBUFFER_INCOMPLETE_VIEW_TARGETS_OVR 0x9633 +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREMULTIVIEWOVRPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferTextureMultiviewOVR (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +GLAPI void APIENTRY glNamedFramebufferTextureMultiviewOVR (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint baseViewIndex, GLsizei numViews); +#endif +#endif /* GL_OVR_multiview */ + +#ifndef GL_OVR_multiview2 +#define GL_OVR_multiview2 1 +#endif /* GL_OVR_multiview2 */ + +#ifdef __cplusplus +} +#endif + +#endif diff --git a/TSE_GlfwOpenGlImpl/include/KHR/khrplatform.h b/TSE_GlfwOpenGlImpl/include/KHR/khrplatform.h new file mode 100644 index 0000000..35b63c8 --- /dev/null +++ b/TSE_GlfwOpenGlImpl/include/KHR/khrplatform.h @@ -0,0 +1,311 @@ +#ifndef __khrplatform_h_ +#define __khrplatform_h_ + +/* +** Copyright (c) 2008-2018 The Khronos Group Inc. +** +** Permission is hereby granted, free of charge, to any person obtaining a +** copy of this software and/or associated documentation files (the +** "Materials"), to deal in the Materials without restriction, including +** without limitation the rights to use, copy, modify, merge, publish, +** distribute, sublicense, and/or sell copies of the Materials, and to +** permit persons to whom the Materials are furnished to do so, subject to +** the following conditions: +** +** The above copyright notice and this permission notice shall be included +** in all copies or substantial portions of the Materials. +** +** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. +** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY +** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, +** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE +** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. +*/ + +/* Khronos platform-specific types and definitions. + * + * The master copy of khrplatform.h is maintained in the Khronos EGL + * Registry repository at https://github.com/KhronosGroup/EGL-Registry + * The last semantic modification to khrplatform.h was at commit ID: + * 67a3e0864c2d75ea5287b9f3d2eb74a745936692 + * + * Adopters may modify this file to suit their platform. Adopters are + * encouraged to submit platform specific modifications to the Khronos + * group so that they can be included in future versions of this file. + * Please submit changes by filing pull requests or issues on + * the EGL Registry repository linked above. + * + * + * See the Implementer's Guidelines for information about where this file + * should be located on your system and for more details of its use: + * http://www.khronos.org/registry/implementers_guide.pdf + * + * This file should be included as + * #include + * by Khronos client API header files that use its types and defines. + * + * The types in khrplatform.h should only be used to define API-specific types. + * + * Types defined in khrplatform.h: + * khronos_int8_t signed 8 bit + * khronos_uint8_t unsigned 8 bit + * khronos_int16_t signed 16 bit + * khronos_uint16_t unsigned 16 bit + * khronos_int32_t signed 32 bit + * khronos_uint32_t unsigned 32 bit + * khronos_int64_t signed 64 bit + * khronos_uint64_t unsigned 64 bit + * khronos_intptr_t signed same number of bits as a pointer + * khronos_uintptr_t unsigned same number of bits as a pointer + * khronos_ssize_t signed size + * khronos_usize_t unsigned size + * khronos_float_t signed 32 bit floating point + * khronos_time_ns_t unsigned 64 bit time in nanoseconds + * khronos_utime_nanoseconds_t unsigned time interval or absolute time in + * nanoseconds + * khronos_stime_nanoseconds_t signed time interval in nanoseconds + * khronos_boolean_enum_t enumerated boolean type. This should + * only be used as a base type when a client API's boolean type is + * an enum. Client APIs which use an integer or other type for + * booleans cannot use this as the base type for their boolean. + * + * Tokens defined in khrplatform.h: + * + * KHRONOS_FALSE, KHRONOS_TRUE Enumerated boolean false/true values. + * + * KHRONOS_SUPPORT_INT64 is 1 if 64 bit integers are supported; otherwise 0. + * KHRONOS_SUPPORT_FLOAT is 1 if floats are supported; otherwise 0. + * + * Calling convention macros defined in this file: + * KHRONOS_APICALL + * KHRONOS_APIENTRY + * KHRONOS_APIATTRIBUTES + * + * These may be used in function prototypes as: + * + * KHRONOS_APICALL void KHRONOS_APIENTRY funcname( + * int arg1, + * int arg2) KHRONOS_APIATTRIBUTES; + */ + +#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC) +# define KHRONOS_STATIC 1 +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APICALL + *------------------------------------------------------------------------- + * This precedes the return type of the function in the function prototype. + */ +#if defined(KHRONOS_STATIC) + /* If the preprocessor constant KHRONOS_STATIC is defined, make the + * header compatible with static linking. */ +# define KHRONOS_APICALL +#elif defined(_WIN32) +# define KHRONOS_APICALL __declspec(dllimport) +#elif defined (__SYMBIAN32__) +# define KHRONOS_APICALL IMPORT_C +#elif defined(__ANDROID__) +# define KHRONOS_APICALL __attribute__((visibility("default"))) +#else +# define KHRONOS_APICALL +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APIENTRY + *------------------------------------------------------------------------- + * This follows the return type of the function and precedes the function + * name in the function prototype. + */ +#if defined(_WIN32) && !defined(_WIN32_WCE) && !defined(__SCITECH_SNAP__) + /* Win32 but not WinCE */ +# define KHRONOS_APIENTRY __stdcall +#else +# define KHRONOS_APIENTRY +#endif + +/*------------------------------------------------------------------------- + * Definition of KHRONOS_APIATTRIBUTES + *------------------------------------------------------------------------- + * This follows the closing parenthesis of the function prototype arguments. + */ +#if defined (__ARMCC_2__) +#define KHRONOS_APIATTRIBUTES __softfp +#else +#define KHRONOS_APIATTRIBUTES +#endif + +/*------------------------------------------------------------------------- + * basic type definitions + *-----------------------------------------------------------------------*/ +#if (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || defined(__GNUC__) || defined(__SCO__) || defined(__USLC__) + + +/* + * Using + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 +/* + * To support platform where unsigned long cannot be used interchangeably with + * inptr_t (e.g. CHERI-extended ISAs), we can use the stdint.h intptr_t. + * Ideally, we could just use (u)intptr_t everywhere, but this could result in + * ABI breakage if khronos_uintptr_t is changed from unsigned long to + * unsigned long long or similar (this results in different C++ name mangling). + * To avoid changes for existing platforms, we restrict usage of intptr_t to + * platforms where the size of a pointer is larger than the size of long. + */ +#if defined(__SIZEOF_LONG__) && defined(__SIZEOF_POINTER__) +#if __SIZEOF_POINTER__ > __SIZEOF_LONG__ +#define KHRONOS_USE_INTPTR_T +#endif +#endif + +#elif defined(__VMS ) || defined(__sgi) + +/* + * Using + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif defined(_WIN32) && !defined(__SCITECH_SNAP__) + +/* + * Win32 + */ +typedef __int32 khronos_int32_t; +typedef unsigned __int32 khronos_uint32_t; +typedef __int64 khronos_int64_t; +typedef unsigned __int64 khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif defined(__sun__) || defined(__digital__) + +/* + * Sun or Digital + */ +typedef int khronos_int32_t; +typedef unsigned int khronos_uint32_t; +#if defined(__arch64__) || defined(_LP64) +typedef long int khronos_int64_t; +typedef unsigned long int khronos_uint64_t; +#else +typedef long long int khronos_int64_t; +typedef unsigned long long int khronos_uint64_t; +#endif /* __arch64__ */ +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#elif 0 + +/* + * Hypothetical platform with no float or int64 support + */ +typedef int khronos_int32_t; +typedef unsigned int khronos_uint32_t; +#define KHRONOS_SUPPORT_INT64 0 +#define KHRONOS_SUPPORT_FLOAT 0 + +#else + +/* + * Generic fallback + */ +#include +typedef int32_t khronos_int32_t; +typedef uint32_t khronos_uint32_t; +typedef int64_t khronos_int64_t; +typedef uint64_t khronos_uint64_t; +#define KHRONOS_SUPPORT_INT64 1 +#define KHRONOS_SUPPORT_FLOAT 1 + +#endif + + +/* + * Types that are (so far) the same on all platforms + */ +typedef signed char khronos_int8_t; +typedef unsigned char khronos_uint8_t; +typedef signed short int khronos_int16_t; +typedef unsigned short int khronos_uint16_t; + +/* + * Types that differ between LLP64 and LP64 architectures - in LLP64, + * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears + * to be the only LLP64 architecture in current use. + */ +#ifdef KHRONOS_USE_INTPTR_T +typedef intptr_t khronos_intptr_t; +typedef uintptr_t khronos_uintptr_t; +#elif defined(_WIN64) +typedef signed long long int khronos_intptr_t; +typedef unsigned long long int khronos_uintptr_t; +#else +typedef signed long int khronos_intptr_t; +typedef unsigned long int khronos_uintptr_t; +#endif + +#if defined(_WIN64) +typedef signed long long int khronos_ssize_t; +typedef unsigned long long int khronos_usize_t; +#else +typedef signed long int khronos_ssize_t; +typedef unsigned long int khronos_usize_t; +#endif + +#if KHRONOS_SUPPORT_FLOAT +/* + * Float type + */ +typedef float khronos_float_t; +#endif + +#if KHRONOS_SUPPORT_INT64 +/* Time types + * + * These types can be used to represent a time interval in nanoseconds or + * an absolute Unadjusted System Time. Unadjusted System Time is the number + * of nanoseconds since some arbitrary system event (e.g. since the last + * time the system booted). The Unadjusted System Time is an unsigned + * 64 bit value that wraps back to 0 every 584 years. Time intervals + * may be either signed or unsigned. + */ +typedef khronos_uint64_t khronos_utime_nanoseconds_t; +typedef khronos_int64_t khronos_stime_nanoseconds_t; +#endif + +/* + * Dummy value used to pad enum types to 32 bits. + */ +#ifndef KHRONOS_MAX_ENUM +#define KHRONOS_MAX_ENUM 0x7FFFFFFF +#endif + +/* + * Enumerated boolean type + * + * Values other than zero should be considered to be true. Therefore + * comparisons should not be made against KHRONOS_TRUE. + */ +typedef enum { + KHRONOS_FALSE = 0, + KHRONOS_TRUE = 1, + KHRONOS_BOOLEAN_ENUM_FORCE_SIZE = KHRONOS_MAX_ENUM +} khronos_boolean_enum_t; + +#endif /* __khrplatform_h_ */ diff --git a/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.cpp b/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.cpp new file mode 100644 index 0000000..97714e6 --- /dev/null +++ b/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.cpp @@ -0,0 +1,94 @@ +#include "OpenGLRenderingBackend.hpp" +#include "GL/gl3w.h" +#include "GLFW/glfw3.h" +#include "GL/gl.h" +#include "WindowGlfw.hpp" +#include "Debug.hpp" + +TSE::GLFW::OpenGLRenderingBackend::OpenGLRenderingBackend(Color _backgroundColor, bool _vsync) +: OpenGLRenderingBackend(_backgroundColor, _vsync, 0, false){ } + +TSE::GLFW::OpenGLRenderingBackend::OpenGLRenderingBackend(Color _backgroundColor, bool _vsync, int _samples, bool _useseImGui) +{ + backgroundColor = _backgroundColor; + vsync = _vsync; + samples = _samples; + useseImGui = _useseImGui; +} + +void TSE::GLFW::OpenGLRenderingBackend::InitPreWindow() +{ + glfwWindowHint(GLFW_CONTEXT_VERSION_MAJOR, TSE_OPENGL_VERSION_MAJOR); + glfwWindowHint(GLFW_CONTEXT_VERSION_MINOR, TSE_OPENGL_VERSION_MINOR); + glfwWindowHint(GLFW_OPENGL_DEBUG_CONTEXT, 1); + glfwWindowHint(GLFW_OPENGL_PROFILE, GLFW_OPENGL_CORE_PROFILE); + glfwWindowHint(GLFW_SAMPLES, samples); +} + +bool TSE::GLFW::OpenGLRenderingBackend::InitPostWindow() +{ + WindowGlfw* wnd = static_cast(window); + glfwMakeContextCurrent(wnd->window); + if(gl3wInit()) + { + Debug::Log("Failed to initialize gl3w."); + return false; + } + if(!gl3wIsSupported(TSE_OPENGL_VERSION_MAJOR, TSE_OPENGL_VERSION_MINOR)) + { + Debug::Log("gl3w dose not support the selected version of OpenGL."); + return false; + } + + if(vsync) glfwSwapInterval(1); + else glfwSwapInterval(0); + + Debug::Log("OpenGL:" + std::string((const char*)glGetString(GL_VERSION))); + Debug::Log("GLSL:" + std::string((const char*)glGetString(GL_SHADING_LANGUAGE_VERSION))); + + glEnable(GL_BLEND); + glClearDepth(0.0); + glEnable(GL_DEPTH_TEST); + glDepthFunc(GL_GEQUAL); + glEnable(GL_MULTISAMPLE); + glEnable(GL_CULL_FACE); + glCullFace(GL_FRONT); + glFrontFace(GL_CW); + glBlendFunc(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA); + glClearColor(backgroundColor.r, backgroundColor.g, backgroundColor.b, backgroundColor.a); + glPointParameteri(GL_POINT_SPRITE_COORD_ORIGIN, GL_LOWER_LEFT); + glPixelStorei(GL_UNPACK_ALIGNMENT, 1); + + return true; +} + +void TSE::GLFW::OpenGLRenderingBackend::onResize(int width, int height) +{ + glViewport(0,0,width, height); +} + +void TSE::GLFW::OpenGLRenderingBackend::onUpdate() const +{ + int error = glGetError(); + if(error != GL_NO_ERROR) + { + Debug::Log("OpenGL Error: " + std::to_string(error)); + } + + WindowGlfw* wnd = static_cast(window); + glfwSwapBuffers(wnd->window); +} + +void TSE::GLFW::OpenGLRenderingBackend::onClear() const +{ + //cameras + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); +} + +void TSE::GLFW::OpenGLRenderingBackend::onClearDepthBuffer() const +{ + //cameras + + glClear(GL_DEPTH_BUFFER_BIT); +} diff --git a/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.hpp b/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.hpp new file mode 100644 index 0000000..9ffde6f --- /dev/null +++ b/TSE_GlfwOpenGlImpl/src/OpenGLRenderingBackend.hpp @@ -0,0 +1,26 @@ +#pragma once + +#include "interfaces/IRenderingBackend.hpp" + +#define TSE_OPENGL_VERSION_MAJOR 3 +#define TSE_OPENGL_VERSION_MINOR 3 + +namespace TSE::GLFW +{ + class OpenGLRenderingBackend : public IRenderingBackend + { + private: + + public: + OpenGLRenderingBackend(Color _backgroundColor, bool _vsync); + OpenGLRenderingBackend(Color _backgroundColor, bool _vsync, int _samples, bool _useseImGui); + + void InitPreWindow() override; + bool InitPostWindow() override; + + void onResize(int width, int height) override; + void onUpdate() const override; + void onClear() const override; + void onClearDepthBuffer() const override; + }; +} // namespace TSE diff --git a/TSE_Math/CMakeLists.txt b/TSE_Math/CMakeLists.txt index 150e38b..f1483d6 100644 --- a/TSE_Math/CMakeLists.txt +++ b/TSE_Math/CMakeLists.txt @@ -43,7 +43,6 @@ include_directories(${PROJECT_SOURCE_DIR}/src) include_directories(${PROJECT_SOURCE_DIR}/../TSE_Base/src) #project def -#add_library(TSE_Math STATIC ${CPP_SOURCE_TSE}) if(Lib) add_library(TSE_Math SHARED ${CPP_SOURCE_TSE}) else()